Comparing GFF4516 FitnessBrowser__WCS417:GFF4516 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
29% identity, 87% coverage: 10:239/263 of query aligns to 1:236/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
29% identity, 87% coverage: 10:239/263 of query aligns to 1:236/261 of 3klcA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
29% identity, 87% coverage: 10:239/263 of query aligns to 2:237/262 of Q9UYV8
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
27% identity, 94% coverage: 7:252/263 of query aligns to 1:259/276 of Q9NQR4
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 89% coverage: 22:254/263 of query aligns to 48:299/307 of Q94JV5
Sites not aligning to the query:
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
27% identity, 89% coverage: 10:242/263 of query aligns to 3:241/263 of 7ovgA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
26% identity, 89% coverage: 10:242/263 of query aligns to 9:247/269 of 6ypaB
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
29% identity, 92% coverage: 9:251/263 of query aligns to 1:249/254 of 4izuA
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
29% identity, 89% coverage: 9:243/263 of query aligns to 9:249/263 of 4iztA
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
30% identity, 89% coverage: 9:241/263 of query aligns to 8:246/261 of 5nycA
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
30% identity, 89% coverage: 9:241/263 of query aligns to 8:246/261 of 4izsA
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
29% identity, 89% coverage: 9:243/263 of query aligns to 8:248/262 of 5nybA
5ny7A A c145a mutant of nesterenkonia an1 amidase bound to nicotinamide
29% identity, 89% coverage: 9:243/263 of query aligns to 8:248/262 of 5ny7A
Sites not aligning to the query:
O25067 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
26% identity, 89% coverage: 3:236/263 of query aligns to 5:253/339 of O25067
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
27% identity, 83% coverage: 23:240/263 of query aligns to 17:264/297 of 5h8jB
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
27% identity, 83% coverage: 23:240/263 of query aligns to 21:268/301 of 5h8iC
P11436 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
25% identity, 73% coverage: 40:232/263 of query aligns to 51:250/346 of P11436
5khaA Structure of glutamine-dependent NAD+ synthetase from acinetobacter baumannii in complex with adenosine diphosphate (adp)
26% identity, 74% coverage: 34:228/263 of query aligns to 24:228/526 of 5khaA
Sites not aligning to the query:
Q9RQ17 Aliphatic amidase; Acylamide amidohydrolase; Wide spectrum amidase; EC 3.5.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
23% identity, 88% coverage: 6:236/263 of query aligns to 16:254/348 of Q9RQ17
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 69% coverage: 23:203/263 of query aligns to 18:226/307 of P47016
>GFF4516 FitnessBrowser__WCS417:GFF4516
MRDLSALPNLNIALVQTNLAWHDRQANLEHFELLLEQAQGADLIVLPEMFTTGFSMESQT
LAEPEYGPAHHWLQAQAAKYNAVITGSVIIQAADGSHRNRLLWARPDGEVLHYDKRHLFR
MAGEHNHYTPGERQVQFELKGWRIRPLICYDLRFPVWSRDAQDTDLLLYTANWPGARRSH
WNRLLPARAIENLCYVAAVNRVGTDGKGFAYTGDSQVLDFQGETLLSAGEADGVFQVNLD
AAELAAYRTRFPANLDADTFQFV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory