Comparing GFF456 FitnessBrowser__Marino:GFF456 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
2x65B Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with mannose-1-phosphate. (see paper)
38% identity, 74% coverage: 1:350/473 of query aligns to 1:332/334 of 2x65B
2x65A Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with mannose-1-phosphate. (see paper)
38% identity, 74% coverage: 1:350/473 of query aligns to 1:332/334 of 2x65A
2x60A Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with gtp. (see paper)
38% identity, 74% coverage: 1:350/473 of query aligns to 1:332/333 of 2x60A
2x5zA Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with gdp-mannose. (see paper)
38% identity, 74% coverage: 1:350/473 of query aligns to 1:332/333 of 2x5zA
>GFF456 FitnessBrowser__Marino:GFF456
MIHPVIMAGGTGSRLWPMSRQLNPKQFLKLTNGPLSMLQATVARLEGMDAANPLLICNEE
HRFLAAEQMRQSGHEDTRIILEPCGRNTAPAIALAALQLTEAAENGADDPLMLVLAADHL
IKDVTAFQEGVKKAIPLAREGKLVTFGIVPNHPETGYGYIHRGTELGPDSYLVDKFVEKP
DQATANGYLDSGEYLWNSGMFLFGARQYLEELEAHRPDILAACRAAIADTADDLHFTRIN
AERFAECPSDSVDYAVMEKTDKAAVVSLDAGWSDIGSWSALWEVSDKDADGNSLTGDVIT
HNTANTLIRADSRLVATVGVDNLVVIETKDALLVAHKDSVQDVKTVVERIKTDGRHEHMN
HREVYRPWGVYDSIDNGARYQVKRITVKPGAKLSVQMHHHRAEHWIVVSGTARVTNGEKT
YLVTENQSTYIPVGQVHSLENPGVIDLELIEVQSGSYLGEDDIVRYEDRYGRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory