SitesBLAST
Comparing GFF4590 FitnessBrowser__WCS417:GFF4590 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bt9C Crystal structure of folm alternative dihydrofolate reductase 1 from brucella canis complexed with NADP (see paper)
27% identity, 98% coverage: 5:235/236 of query aligns to 7:242/250 of 5bt9C
- active site: R18 (= R16), I140 (= I133), Y155 (= Y148), K159 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R18 (= R16), I19 (≠ V17), C38 (≠ S35), N39 (≠ Y36), R40 (= R37), S41 (= S38), L66 (≠ S60), E67 (= E61), N90 (= N84), S92 (= S86), I140 (= I133), K159 (= K152), P184 (= P177), G185 (≠ A178), T187 (≠ V180), L188 (≠ M181)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
26% identity, 100% coverage: 1:235/236 of query aligns to 1:243/244 of 6wprA
- active site: G16 (≠ R16), S138 (≠ D135), Y151 (= Y148)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ Q15), T37 (≠ R37), L58 (≠ A56), D59 (= D57), V60 (≠ F58), N86 (= N84), A87 (= A85), G88 (vs. gap), I89 (vs. gap), I136 (= I133), Y151 (= Y148), K155 (= K152), P181 (= P177)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
29% identity, 96% coverage: 9:234/236 of query aligns to 10:239/241 of 5t2uA
- active site: G17 (≠ R16), T135 (≠ D135), T145 (≠ H145), Y148 (= Y148), K152 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), G17 (≠ R16), R38 (= R37), D39 (≠ S38), R42 (≠ P41), D60 (≠ E61), L61 (≠ A62), N83 (= N84), A84 (= A85), Y87 (≠ W88), I133 (= I133), T135 (≠ D135), Y148 (= Y148), K152 (= K152), P178 (= P177), P180 (vs. gap), T181 (vs. gap), T183 (vs. gap), T185 (≠ M179), T186 (≠ V180)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
26% identity, 96% coverage: 9:235/236 of query aligns to 9:243/244 of 6t62A
- active site: G16 (≠ R16), S138 (≠ D135), Y151 (= Y148)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ Q15), A36 (≠ Y36), T37 (≠ R37), L58 (≠ A56), D59 (= D57), V60 (≠ F58), N86 (= N84), A87 (= A85), G88 (vs. gap), I89 (vs. gap), I136 (= I133), S137 (= S134), S138 (≠ D135), Y151 (= Y148), K155 (= K152), P181 (= P177), G182 (≠ A178), I184 (≠ V180), M188 (≠ F182)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
25% identity, 96% coverage: 8:233/236 of query aligns to 7:250/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G12), S13 (≠ G14), R14 (≠ Q15), G15 (≠ R16), I16 (≠ V17), L36 (≠ R37), R37 (≠ S38), N38 (≠ E39), A61 (= A56), D62 (= D57), V63 (≠ F58), N89 (= N84), A90 (= A85), G91 (≠ S86), T113 (≠ V106), V143 (≠ I133), S145 (≠ D135), Y159 (= Y148), K163 (= K152), P189 (= P177), G190 (≠ A178), I192 (≠ V180), T194 (vs. gap), I196 (≠ M181), H197 (≠ F182)
5ojiA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
25% identity, 95% coverage: 9:232/236 of query aligns to 14:255/260 of 5ojiA
- active site: G21 (≠ R16), S148 (≠ D135), Y161 (= Y148), K165 (= K152)
- binding isatin: S148 (≠ D135), S150 (≠ V137), Y161 (= Y148), V193 (≠ M179), S199 (vs. gap), L202 (≠ M181)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G12), T19 (≠ G14), I22 (≠ V17), S41 (≠ Y36), R42 (= R37), N43 (≠ S38), N46 (vs. gap), I69 (= I68), N95 (= N84), H96 (vs. gap), G97 (vs. gap), N146 (≠ I133), S148 (≠ D135), Y161 (= Y148), K165 (= K152), G192 (≠ A178), I194 (vs. gap), T196 (vs. gap), M198 (vs. gap)
5ojgA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
25% identity, 95% coverage: 9:232/236 of query aligns to 14:255/260 of 5ojgA
- active site: G21 (≠ R16), S148 (≠ D135), Y161 (= Y148), K165 (= K152)
- binding butane-2,3-dione: S148 (≠ D135), Y161 (= Y148)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G12), T19 (≠ G14), G21 (≠ R16), I22 (≠ V17), S41 (≠ Y36), R42 (= R37), N43 (≠ S38), N46 (vs. gap), I69 (= I68), N95 (= N84), H96 (vs. gap), G97 (vs. gap), N146 (≠ I133), S148 (≠ D135), Y161 (= Y148), K165 (= K152), P191 (= P177), I194 (vs. gap), T196 (vs. gap), M198 (vs. gap)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
24% identity, 98% coverage: 1:232/236 of query aligns to 1:244/247 of 4jroC
- active site: G16 (≠ R16), S142 (≠ D135), Q152 (≠ H145), Y155 (= Y148), K159 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ Q15), G16 (≠ R16), I17 (≠ V17), N35 (≠ S35), Y36 (= Y36), N37 (≠ R37), G38 (≠ S38), S39 (≠ E39), N63 (≠ R49), V64 (≠ G50), N90 (= N84), A91 (= A85), I93 (vs. gap), I113 (≠ V106), S142 (≠ D135), Y155 (= Y148), K159 (= K152), P185 (= P177), I188 (≠ V180), T190 (≠ F182)
3h4vA Selective screening and design to identify inhibitors of leishmania major pteridine reductase 1 (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:267/273 of 3h4vA
- active site: R13 (= R16), D166 (= D135), Y179 (= Y148)
- binding methyl 1-(4-{[(2,4-diaminopteridin-6-yl)methyl]amino}benzoyl)piperidine-4-carboxylate: S105 (= S86), F107 (≠ W88), L173 (≠ S142), Y179 (= Y148), L211 (≠ M179)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), L14 (≠ V17), H32 (≠ S35), Y33 (= Y36), H34 (vs. gap), R35 (vs. gap), S36 (vs. gap), L62 (≠ R47), N103 (= N84), A104 (= A85), S105 (= S86), S106 (≠ A87), M164 (≠ I133), V165 (≠ S134), K183 (= K152), P209 (= P177), L211 (≠ M179), S212 (vs. gap)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
26% identity, 96% coverage: 9:235/236 of query aligns to 9:239/239 of 4nbtA
- active site: G16 (≠ R16), S132 (≠ D135), Y145 (= Y148), K149 (= K152)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), K15 (≠ Q15), G16 (≠ R16), L17 (≠ V17), D36 (vs. gap), L37 (vs. gap), L52 (≠ A56), N53 (≠ D57), V54 (≠ F58), N80 (= N84), A81 (= A85), G82 (≠ S86), I130 (= I133), S132 (≠ D135), Y145 (= Y148), K149 (= K152), P177 (= P177), G178 (≠ A178), I180 (≠ V180), T182 (≠ F182)
3d3wA Structure of l-xylulose reductase with bound coenzyme, phosphate and hydroxide. (see paper)
26% identity, 95% coverage: 8:232/236 of query aligns to 10:240/244 of 3d3wA
- active site: G18 (≠ R16), S136 (≠ D135), H146 (= H145), Y149 (= Y148), K153 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G12), G16 (= G14), K17 (≠ Q15), G18 (≠ R16), I19 (≠ V17), S38 (≠ Y36), R39 (= R37), T40 (≠ S38), V59 (≠ A48), L61 (≠ F55), N83 (= N84), A84 (= A85), A85 (≠ S86), V106 (= V106), V134 (≠ I133), S135 (= S134), S136 (≠ D135), Y149 (= Y148), K153 (= K152), P179 (= P177), T180 (≠ A178), V182 (= V180), T184 (≠ F182), S185 (≠ N183), M186 (≠ D184), G187 (= G185)
1pr9A Human l-xylulose reductase holoenzyme (see paper)
26% identity, 95% coverage: 8:232/236 of query aligns to 10:240/244 of 1pr9A
- active site: G18 (≠ R16), S136 (≠ D135), H146 (= H145), Y149 (= Y148), K153 (= K152)
- binding dihydrogenphosphate ion: S136 (≠ D135), C138 (≠ V137)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G12), G16 (= G14), K17 (≠ Q15), G18 (≠ R16), I19 (≠ V17), S38 (≠ Y36), R39 (= R37), T40 (≠ S38), L61 (≠ F55), N83 (= N84), A85 (≠ S86), V106 (= V106), V134 (≠ I133), Y149 (= Y148), K153 (= K152), T180 (≠ A178), V182 (= V180), T184 (≠ F182), M186 (≠ D184)
Q7Z4W1 L-xylulose reductase; XR; Carbonyl reductase II; Dicarbonyl/L-xylulose reductase; Kidney dicarbonyl reductase; kiDCR; Short chain dehydrogenase/reductase family 20C member 1; Sperm surface protein P34H; EC 1.1.1.10 from Homo sapiens (Human) (see 2 papers)
26% identity, 95% coverage: 8:232/236 of query aligns to 10:240/244 of Q7Z4W1
- 11:40 (vs. 9:38, 37% identical) binding
- N107 (≠ H107) mutation N->L,D: Loss of function. Probably due to defects in formation of the active site and binding of coenzyme.
- S136 (≠ D135) binding
- K153 (= K152) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
7opjA Trypanosoma brucei ptr1 (tbptr1) in complex with pyrimethamine (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:244/250 of 7opjA
- binding 5-(4-chloro-phenyl)-6-ethyl-pyrimidine-2,4-diamine: S94 (= S86), F96 (≠ W88), Y156 (= Y148), P192 (≠ N183)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), H32 (≠ S35), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L141 (≠ I133), D143 (= D135), K160 (= K152), P186 (= P177), G187 (≠ A178), V188 (≠ M179), S189 (≠ V180), L190 (≠ M181)
6gd4A Trypanosoma brucei ptr1 in complex with inhibitor 4c (f188) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:244/250 of 6gd4A
- active site: R13 (= R16), D143 (= D135), Y156 (= Y148), K160 (= K152)
- binding 2-amino-1,3-benzothiazole-6-carboxamide: S94 (= S86), F96 (≠ W88), D143 (= D135), Y156 (= Y148)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), S94 (= S86), T117 (≠ V106), L141 (≠ I133), K160 (= K152), P186 (= P177), G187 (≠ A178), S189 (≠ V180)
6gclA Trypanosoma brucei ptr1 in complex with inhibitor 3a (f020) (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:244/250 of 6gclA
- active site: R13 (= R16), D143 (= D135), Y156 (= Y148), K160 (= K152)
- binding 6-methylsulfonyl-1,3-benzothiazol-2-amine: S94 (= S86), F96 (≠ W88), Y156 (= Y148), P192 (≠ N183)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), L62 (≠ F58), N92 (= N84), S94 (= S86), T117 (≠ V106), L141 (≠ I133), K160 (= K152), P186 (= P177), G187 (≠ A178), S189 (≠ V180), L190 (≠ M181)
4wcdA Trypanosoma brucei ptr1 in complex with inhibitor 10 (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:244/250 of 4wcdA
- active site: R13 (= R16), D143 (= D135), Y156 (= Y148), K160 (= K152)
- binding 5-(1H-benzotriazol-6-yl)-1,3,4-thiadiazol-2-amine: F96 (≠ W88), V188 (≠ M179), P192 (≠ N183), W203 (≠ V194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L141 (≠ I133), K160 (= K152), P186 (= P177), G187 (≠ A178), S189 (≠ V180), L190 (≠ M181)
4cmkA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:244/250 of 4cmkA
- active site: R13 (= R16), D143 (= D135), Y156 (= Y148), K160 (= K152)
- binding 2-amino-5-phenethyl-6-phenyl-3H-pyrrolo[2,3-d]pyrimidin-4(7H)-one: S94 (= S86), F96 (≠ W88), D143 (= D135), M145 (≠ V137), C150 (≠ S142), F153 (≠ H145), Y156 (= Y148), G187 (≠ A178), V188 (≠ M179), P192 (≠ N183)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L141 (≠ I133), K160 (= K152), P186 (= P177), G187 (≠ A178), V188 (≠ M179), S189 (≠ V180)
4cm8A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:244/250 of 4cm8A
- active site: R13 (= R16), D143 (= D135), Y156 (= Y148), K160 (= K152)
- binding (E)-2,4-diamino-6-(4-methylstyryl)-7H-pyrrolo[2,3-d]pyrimidine-5-carbonitrile: S94 (= S86), F96 (≠ W88), D143 (= D135), M145 (≠ V137), C150 (≠ S142), Y156 (= Y148), W203 (≠ V194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), Y33 (= Y36), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L141 (≠ I133), K160 (= K152), P186 (= P177), G187 (≠ A178), S189 (≠ V180), L190 (≠ M181)
4clrA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
27% identity, 95% coverage: 9:232/236 of query aligns to 6:244/250 of 4clrA
- active site: R13 (= R16), D143 (= D135), Y156 (= Y148), K160 (= K152)
- binding 2-amino-5-methyl-3H-pyrrolo[2,3-d]pyrimidin-4(7H)-one: S94 (= S86), F96 (≠ W88), Y156 (= Y148), P192 (≠ N183)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R16), I14 (≠ V17), H34 (≠ R37), N35 (≠ S38), S36 (≠ E39), D61 (= D57), L62 (≠ F58), N92 (= N84), A93 (= A85), S94 (= S86), T117 (≠ V106), L141 (≠ I133), K160 (= K152), P186 (= P177), G187 (≠ A178), V188 (≠ M179), S189 (≠ V180), L190 (≠ M181)
Query Sequence
>GFF4590 FitnessBrowser__WCS417:GFF4590
MTATNAPILITGAGQRVGLHCAQRLLDEGHPVIFSYRSERPGVQALRARGAVGLFADFSS
EAGILAFIAELNTHTQSLRAIIHNASAWIAETPDDESRAFTDMFSVHMLAPYLINLHCSP
LLQRSSPADIVHISDDVVRKGSRQHIAYCATKAGLDSLTLSFAAQFAPLIKVNGIAPAMV
MFNDGDDADYRAKVLAKSALGIEPGPEVIYQSVRYLLDNPYVTGTTLTVNGGRHIK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory