Comparing GFF460 FitnessBrowser__psRCH2:GFF460 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
36% identity, 68% coverage: 40:198/234 of query aligns to 16:194/212 of 4husA
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
36% identity, 68% coverage: 40:198/234 of query aligns to 16:194/211 of 4hurA
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
36% identity, 68% coverage: 40:198/234 of query aligns to 16:194/206 of 6x3jA
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
36% identity, 68% coverage: 40:198/234 of query aligns to 16:194/207 of 6x3cA
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
36% identity, 68% coverage: 40:198/234 of query aligns to 16:194/203 of 6x3cE
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
43% identity, 53% coverage: 72:194/234 of query aligns to 61:188/210 of 6pubA
Sites not aligning to the query:
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
43% identity, 53% coverage: 72:194/234 of query aligns to 58:185/206 of 6u9cA
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
34% identity, 59% coverage: 49:187/234 of query aligns to 26:183/206 of 1khrA
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
34% identity, 59% coverage: 49:187/234 of query aligns to 26:183/203 of 3dhoA
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
34% identity, 59% coverage: 49:187/234 of query aligns to 26:183/204 of 1mrlA
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
34% identity, 59% coverage: 49:187/234 of query aligns to 26:183/205 of 1kk4A
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
34% identity, 59% coverage: 49:187/234 of query aligns to 26:183/209 of P50870
2xatA Complex of the hexapeptide xenobiotic acetyltransferase with chloramphenicol and desulfo-coenzyme a (see paper)
39% identity, 54% coverage: 72:198/234 of query aligns to 57:190/208 of 2xatA
Sites not aligning to the query:
6pxaE The crystal structure of chloramphenicol acetyltransferase-like protein from vibrio fischeri es114 in complex with taurocholic acid
35% identity, 53% coverage: 72:194/234 of query aligns to 73:197/221 of 6pxaE
Sites not aligning to the query:
5ux9A The crystal structure of chloramphenicol acetyltransferase from vibrio fischeri es114
35% identity, 53% coverage: 72:194/234 of query aligns to 68:192/215 of 5ux9A
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
47% identity, 32% coverage: 95:168/234 of query aligns to 112:184/188 of 3igjC
Sites not aligning to the query:
7uulA Crystal structure of aminoglycoside resistance enzyme apma, complex with kanamycin b and coenzyme a (see paper)
28% identity, 61% coverage: 52:194/234 of query aligns to 95:256/274 of 7uulA
Sites not aligning to the query:
7uunA Crystal structure of aminoglycoside resistance enzyme apma, complex with neomycin (see paper)
28% identity, 61% coverage: 52:194/234 of query aligns to 95:256/273 of 7uunA
7uumA Crystal structure of aminoglycoside resistance enzyme apma, complex with paromomycin and coenzyme a (see paper)
28% identity, 61% coverage: 52:194/234 of query aligns to 96:257/274 of 7uumA
7uukC Crystal structure of aminoglycoside resistance enzyme apma, complex with tobramycin (see paper)
28% identity, 61% coverage: 52:194/234 of query aligns to 96:257/276 of 7uukC
Sites not aligning to the query:
>GFF460 FitnessBrowser__psRCH2:GFF460
MVIDFVRSYYWKRWLRRRDVKLAAGLASLTASAQVVVEENVRLGDVAIKARDLRIGAYTY
IRSGLLQSVSEIGRFCSIGQEVQIGLSSDAHPLYWLTTHPVHDIAAGLKYDTQKAHARIG
HDVWIGAGVKILSGVTVGDGAVIATGAVVTRHVAPYEIVGGNPAKHIKWRFEDSILRDEI
HKSAWWNLQFEQLKAMPFDNPPECLRYISALGGKAGGGASYSSYRIRKSGCAAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory