SitesBLAST
Comparing GFF4616 FitnessBrowser__WCS417:GFF4616 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
H1ZZB0 Aurachin B dehydrogenase; EC 1.1.1.394 from Stigmatella aurantiaca (see paper)
29% identity, 74% coverage: 1:220/297 of query aligns to 1:226/334 of H1ZZB0
- S111 (= S98) mutation to A: Does not produce aurachin B.
- Y139 (vs. gap) mutation to F: Does not produce aurachin B.
1ketA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound (see paper)
22% identity, 97% coverage: 3:290/297 of query aligns to 5:311/346 of 1ketA
- active site: T123 (≠ G99), D124 (≠ S100), E125 (≠ S101), Y159 (≠ D127), K163 (≠ R131)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), F13 (= F11), I14 (= I12), D35 (≠ T28), K36 (≠ G29), L37 (= L30), T38 (≠ V31), A40 (≠ S33), G41 (≠ V34), D60 (≠ S51), I61 (≠ L52), Y80 (≠ A71), A82 (≠ S73), S84 (≠ D75), T99 (vs. gap), S122 (= S98), T123 (≠ G99), Y159 (≠ D127), K163 (≠ R131)
- binding thymidine-5'-diphosphate: E125 (≠ S101), N188 (≠ L155), F199 (≠ Q169), R202 (= R172), Q203 (≠ L173), K214 (≠ R184), Y216 (≠ V186), R223 (≠ W193), N258 (≠ F227), R282 (≠ G263), H285 (≠ S266)
1kepA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound (see paper)
22% identity, 97% coverage: 3:290/297 of query aligns to 5:311/346 of 1kepA
- active site: T123 (≠ G99), D124 (≠ S100), E125 (≠ S101), Y159 (≠ D127), K163 (≠ R131)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), F13 (= F11), I14 (= I12), D35 (≠ T28), K36 (≠ G29), L37 (= L30), T38 (≠ V31), G41 (≠ V34), D60 (≠ S51), I61 (≠ L52), Y80 (≠ A71), A81 (= A72), A82 (≠ S73), S84 (≠ D75), T99 (vs. gap), S122 (= S98), Y159 (≠ D127), K163 (≠ R131), N189 (≠ I156)
- binding thymidine-5'-diphospho-beta-d-xylose: S84 (≠ D75), T123 (≠ G99), E125 (≠ S101), Y159 (≠ D127), N188 (≠ L155), K198 (≠ R165), R223 (≠ W193), R282 (≠ G263)
1kerB The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-d-glucose bound (see paper)
22% identity, 97% coverage: 3:290/297 of query aligns to 6:312/347 of 1kerB
- active site: T124 (≠ G99), D125 (≠ S100), E126 (≠ S101), Y160 (≠ D127), K164 (≠ R131)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S85 (≠ D75), N87 (≠ R77), T124 (≠ G99), D125 (≠ S100), E126 (≠ S101), Y160 (≠ D127), N189 (≠ L155), K199 (≠ R165), F200 (≠ Q169), R203 (= R172), Q204 (≠ L173), K215 (≠ R184), L216 (≠ H185), Y217 (≠ V186), R224 (≠ W193), N259 (≠ F227), R283 (≠ G263), H286 (≠ S266)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), F14 (= F11), I15 (= I12), D36 (≠ T28), K37 (≠ G29), L38 (= L30), T39 (≠ V31), G42 (≠ V34), D61 (≠ S51), I62 (≠ L52), Y81 (≠ A71), A82 (= A72), A83 (≠ S73), S85 (≠ D75), T100 (vs. gap), S123 (= S98), T124 (≠ G99), Y160 (≠ D127), K164 (≠ R131), C187 (≠ N153), N190 (≠ I156)
Query Sequence
>GFF4616 FitnessBrowser__WCS417:GFF4616
MKVFVTGAAGFIGGSIATGLVKAGHSVTGLVRSVEQAAEMTALGITPVIGSLDDTAVLTE
QAQKADAVINAASSDHRAAVETLLVALKGSNKPFLHTSGSSIVGDASGGKSSEVIYFEDN
LPEPTVDKAARVAIDNLILAAAKEGVNSAVICNTLIYGHSLGVKRDSVQLPRLLKQARKS
GVVRHVGSGQNIWSNVHIEDVVALYLLALTKNVPGTFYFVESSEAAFIDMTTAIAEALNL
GKPQDWPLADAEAEWGYEMANYGLGSNSRVRGKHARERLGWAPKRTSVVEWIRNEMV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory