Comparing GFF4622 FitnessBrowser__WCS417:GFF4622 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P83788 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Pseudomonas fluorescens (see paper)
86% identity, 100% coverage: 1:416/416 of query aligns to 1:416/416 of P83788
1qz9A The three dimensional structure of kynureninase from pseudomonas fluorescens (see paper)
87% identity, 97% coverage: 2:404/416 of query aligns to 1:403/404 of 1qz9A
P70712 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Rattus norvegicus (Rat) (see paper)
27% identity, 95% coverage: 10:405/416 of query aligns to 33:464/464 of P70712
Sites not aligning to the query:
3e9kA Crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex (see paper)
28% identity, 94% coverage: 10:401/416 of query aligns to 28:446/446 of 3e9kA
2hzpA Crystal structure of homo sapiens kynureninase (see paper)
28% identity, 94% coverage: 10:401/416 of query aligns to 28:447/447 of 2hzpA
Q16719 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Homo sapiens (Human) (see 4 papers)
28% identity, 94% coverage: 10:401/416 of query aligns to 33:460/465 of Q16719
Sites not aligning to the query:
8odqD Sufs-sufu complex from mycobacterium tuberculosis (see paper)
24% identity, 89% coverage: 16:385/416 of query aligns to 3:374/410 of 8odqD
1vjoA Crystal structure of alanine--glyoxylate aminotransferase (alr1004) from nostoc sp. At 1.70 a resolution (see paper)
27% identity, 36% coverage: 110:257/416 of query aligns to 85:237/377 of 1vjoA
Sites not aligning to the query:
P96060 2-aminoethylphosphonate--pyruvate transaminase; 2-aminoethylphosphonate aminotransferase; AEP transaminase; AEPT; EC 2.6.1.37 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
26% identity, 36% coverage: 117:266/416 of query aligns to 80:225/367 of P96060
Sites not aligning to the query:
1m32A Crystal structure of 2-aminoethylphosphonate transaminase (see paper)
26% identity, 36% coverage: 117:266/416 of query aligns to 75:220/361 of 1m32A
Sites not aligning to the query:
1m32B Crystal structure of 2-aminoethylphosphonate transaminase (see paper)
26% identity, 36% coverage: 117:266/416 of query aligns to 76:221/362 of 1m32B
Sites not aligning to the query:
7tlmA Structure of atopobium parvulum sufs (see paper)
23% identity, 70% coverage: 18:309/416 of query aligns to 13:308/415 of 7tlmA
P05341 Cysteine desulfurase NifS; Nitrogenase metalloclusters biosynthesis protein NifS; EC 2.8.1.7 from Azotobacter vinelandii (see 2 papers)
25% identity, 48% coverage: 30:227/416 of query aligns to 4:202/402 of P05341
Sites not aligning to the query:
5b87A Crystal structure of a cysteine desulfurase from thermococcus onnurineus na1 in complex with alanine at 2.3 angstrom resolution (see paper)
23% identity, 56% coverage: 80:314/416 of query aligns to 68:299/397 of 5b87A
Sites not aligning to the query:
3lvmB Crystal structure of e.Coli iscs (see paper)
26% identity, 34% coverage: 78:219/416 of query aligns to 62:204/394 of 3lvmB
Sites not aligning to the query:
P0A6B7 Cysteine desulfurase IscS; NifS protein homolog; ThiI transpersulfidase; TusA transpersulfidase; EC 2.8.1.7 from Escherichia coli (strain K12) (see 4 papers)
26% identity, 34% coverage: 78:219/416 of query aligns to 56:198/404 of P0A6B7
Sites not aligning to the query:
P0A6B9 Cysteine desulfurase IscS; EC 2.8.1.7 from Escherichia coli O157:H7 (see paper)
26% identity, 34% coverage: 78:219/416 of query aligns to 56:198/404 of P0A6B9
Sites not aligning to the query:
5b7uA Apo structure of cysteine desulfurase from thermococcus onnurineus na1 at 1.89a (see paper)
23% identity, 56% coverage: 80:314/416 of query aligns to 74:305/402 of 5b7uA
Sites not aligning to the query:
2yrrA Hypothetical alanine aminotransferase (tth0173) from thermus thermophilus hb8
34% identity, 16% coverage: 168:234/416 of query aligns to 127:193/352 of 2yrrA
Sites not aligning to the query:
2yriA Crystal structure of alanine-pyruvate aminotransferase with 2- methylserine
34% identity, 16% coverage: 168:234/416 of query aligns to 127:193/352 of 2yriA
Sites not aligning to the query:
>GFF4622 FitnessBrowser__WCS417:GFF4622
MTTRSHCQALDAQDPLAPLRSQFALPEGVIYLDGNSLGARPVAALARAQAVIAEEWGNGL
IRSWNNAGWADLSLRLGNRLAPLIGARDNEVAITDTTSINLFKVLSAALTVQRQRQPGRK
VIVSEASNFPTDLYIAEGLAELLQQGYSLRLVNSPDELPQAIDQDVAVVMLTHVNYKTGY
MYDMQALTALSHECGALSIWDLAHSAGAVPIDLHQAGADYAIGCTYKYLNGGPGSQAFVW
VNPALVDVVRQPLSGWFGHTRQFAMESTYAPSAGIARYLCGTQPITSLAMVECGLEIFAQ
TDMASLRSKSLALTDLFIALVEARCAAHDLKLITPREHAKRGSHVSFEHPEGYAVIQALI
ARGVIGDYREPRIMRFGFTPLYTRFTEVWEAVEILGDILDNHTWNQPQFKVRNSVT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory