SitesBLAST
Comparing GFF4631 FitnessBrowser__WCS417:GFF4631 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
42% identity, 99% coverage: 2:331/335 of query aligns to 2:335/337 of 1krhA
- active site: C306 (= C302)
- binding flavin-adenine dinucleotide: Y143 (= Y139), R155 (= R151), S156 (= S152), Y157 (= Y153), S158 (= S154), V171 (≠ L166), V172 (= V167), G178 (= G173), K179 (≠ V174), M180 (= M175), S181 (= S176), T219 (= T214), E332 (= E328), F334 (= F330), S335 (≠ T331)
- binding fe2/s2 (inorganic) cluster: M38 (≠ L38), D39 (= D39), C40 (= C40), R41 (= R41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), C82 (= C80)
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
33% identity, 93% coverage: 22:334/335 of query aligns to 17:334/334 of P0DPQ8
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
33% identity, 93% coverage: 22:334/335 of query aligns to 16:333/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (= Y139), R144 (= R151), Q145 (≠ S152), Y146 (= Y153), S147 (= S154), H161 (≠ L166), V162 (= V167), V165 (≠ L170), G168 (= G173), V169 (= V174), A170 (≠ M175), T171 (≠ S176), T214 (= T214), F329 (= F330), P331 (≠ Q332), S333 (≠ N334)
- binding fe2/s2 (inorganic) cluster: C34 (= C40), N35 (≠ R41), G37 (= G43), C39 (= C45), G40 (= G46), C42 (= C48), C74 (= C80)
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
35% identity, 67% coverage: 111:333/335 of query aligns to 15:247/250 of 1tvcA
- active site: Y63 (= Y153), S64 (= S154), L215 (= L301)
- binding dihydroflavine-adenine dinucleotide: N24 (≠ S120), F49 (≠ Y139), R61 (= R151), S62 (= S152), Y63 (= Y153), S64 (= S154), L78 (= L166), I79 (≠ V167), R80 (= R168), L82 (= L170), F87 (≠ M175), G128 (= G215), N155 (≠ R242), E159 (≠ D246), S186 (= S273), G187 (≠ E274), E242 (= E328), F244 (= F330), L245 (≠ T331)
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
30% identity, 89% coverage: 17:315/335 of query aligns to 13:309/326 of 4wqmA
- binding flavin-adenine dinucleotide: C36 (= C40), S38 (≠ E42), W57 (≠ Y61), Y135 (= Y139), R146 (= R151), A147 (≠ S152), Y148 (= Y153), S149 (= S154), I162 (≠ L166), V163 (= V167), G169 (= G173), K170 (≠ V174), V171 (≠ M175), S172 (= S176), S209 (≠ T214)
- binding fe2/s2 (inorganic) cluster: Y34 (≠ L38), C36 (= C40), N37 (≠ R41), G39 (= G43), C41 (= C45), G42 (= G46), C44 (= C48), C76 (= C80)
Sites not aligning to the query:
Q03304 Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component; T4MO; Ferredoxin--NAD(+) reductase; Toluene-4-monooxygenase systme, electron transfer component; EC 1.18.1.3 from Pseudomonas mendocina (see paper)
29% identity, 89% coverage: 17:315/335 of query aligns to 13:309/326 of Q03304
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
28% identity, 93% coverage: 20:330/335 of query aligns to 20:333/334 of 7c3bC
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
27% identity, 93% coverage: 20:330/335 of query aligns to 19:320/321 of 7c3aA
- binding flavin-adenine dinucleotide: C39 (= C40), S41 (≠ E42), W60 (≠ Y61), R152 (= R151), A153 (≠ S152), Y154 (= Y153), S155 (= S154), Y169 (≠ L166), I170 (≠ V167), G176 (= G173), R177 (≠ V174), F178 (≠ M175), S179 (= S176), A218 (≠ T214), F320 (= F330)
- binding fe2/s2 (inorganic) cluster: Y37 (≠ L38), C39 (= C40), A40 (≠ R41), G42 (= G43), C44 (= C45), G45 (= G46), C47 (= C48), C80 (= C80)
Sites not aligning to the query:
7c3bB Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
27% identity, 93% coverage: 20:330/335 of query aligns to 19:305/306 of 7c3bB
7romA Crystal structure of saccharomyces cerevisiae nadh-cytochrome b5 reductase 1 (cbr1) fragment (residues 28-284) bound to fad
28% identity, 60% coverage: 117:317/335 of query aligns to 22:236/255 of 7romA
- binding flavin-adenine dinucleotide: R61 (= R151), S62 (= S152), Y63 (= Y153), T64 (≠ S154), L79 (= L166), V80 (= V167), Y83 (≠ L170), T85 (≠ D172), G86 (= G173), N87 (≠ V174), V88 (≠ M175), S89 (= S176), T127 (= T214), A130 (≠ S217)
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
27% identity, 59% coverage: 132:330/335 of query aligns to 183:396/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R151), Q207 (≠ S152), Y208 (= Y153), S209 (= S154), S222 (≠ L166), V223 (= V167), K224 (≠ R168), E226 (vs. gap), P232 (= P171), G234 (= G173), Y235 (≠ V174), V236 (≠ M175), S237 (= S176), V276 (≠ T214), T279 (≠ S217), V395 (≠ K329), F396 (= F330)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102, 398
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
27% identity, 59% coverage: 132:330/335 of query aligns to 183:396/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R151), Q207 (≠ S152), Y208 (= Y153), S209 (= S154), S222 (≠ L166), V223 (= V167), K224 (≠ R168), E226 (vs. gap), P232 (= P171), G234 (= G173), Y235 (≠ V174), V236 (≠ M175), S237 (= S176), V276 (≠ T214), T279 (≠ S217), F396 (= F330)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98, 126, 130, 133
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
27% identity, 59% coverage: 132:330/335 of query aligns to 183:396/403 of 3ozuA
- binding flavin-adenine dinucleotide: R206 (= R151), Q207 (≠ S152), Y208 (= Y153), S209 (= S154), S222 (≠ L166), V223 (= V167), K224 (≠ R168), E226 (vs. gap), P232 (= P171), G234 (= G173), Y235 (≠ V174), V236 (≠ M175), S237 (= S176), E394 (= E328), V395 (≠ K329)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 397, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: 25, 28, 43, 56, 57, 102, 122, 125, 126
2r6hC Crystal structure of the domain comprising the NAD binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
22% identity, 62% coverage: 123:330/335 of query aligns to 27:288/289 of 2r6hC
- active site: C260 (= C302)
- binding flavin-adenine dinucleotide: Y43 (= Y139), R86 (= R151), A87 (≠ S152), Y88 (= Y153), S89 (= S154), N103 (≠ L166), A107 (vs. gap), T108 (vs. gap), I122 (≠ L170), K123 (≠ P171), P124 (≠ D172), G125 (= G173), I126 (≠ V174), S127 (≠ M175), S128 (= S176), F288 (= F330)
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
27% identity, 59% coverage: 132:330/335 of query aligns to 183:396/403 of P39662
Sites not aligning to the query:
- 60 A→Y: Does not affect phospholipid-binding.
- 98 V→F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
27% identity, 59% coverage: 132:330/335 of query aligns to 183:396/403 of 1cqxA
- binding flavin-adenine dinucleotide: Y190 (= Y139), R206 (= R151), Q207 (≠ S152), Y208 (= Y153), S209 (= S154), S222 (≠ L166), E226 (vs. gap), Q231 (≠ L170), P232 (= P171), G234 (= G173), Y235 (≠ V174), V236 (≠ M175), S237 (= S176), V395 (≠ K329)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 397, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
7qu3A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
25% identity, 54% coverage: 151:330/335 of query aligns to 83:278/279 of 7qu3A
- binding flavin-adenine dinucleotide: R83 (= R151), A84 (≠ S152), Y85 (= Y153), S86 (= S154), N100 (≠ L166), A104 (vs. gap), S105 (vs. gap), L112 (= L170), P113 (= P171), G115 (= G173), Q116 (≠ V174), M117 (= M175), S118 (= S176), A155 (≠ T214), F278 (= F330)
- binding 4-(benzimidazol-1-ylmethyl)benzenecarbonitrile: R102 (= R168), G154 (= G213), G182 (= G240), F226 (≠ Y282), I227 (≠ L283), P252 (= P304), M255 (= M307)
Sites not aligning to the query:
7qu5A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
25% identity, 54% coverage: 151:330/335 of query aligns to 83:278/280 of 7qu5A
- binding flavin-adenine dinucleotide: R83 (= R151), A84 (≠ S152), Y85 (= Y153), S86 (= S154), N100 (≠ L166), A104 (vs. gap), L112 (= L170), P113 (= P171), G115 (= G173), Q116 (≠ V174), M117 (= M175), S118 (= S176), A155 (≠ T214), F278 (= F330)
- binding gamma-Valerolactone: S105 (vs. gap), P108 (vs. gap), D196 (≠ R254), W207 (≠ Y265), H208 (≠ T266), L209 (≠ E267)
Sites not aligning to the query:
7qu0A X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
25% identity, 54% coverage: 151:330/335 of query aligns to 83:279/279 of 7qu0A
- binding ~{N}-[2,6-bis(fluoranyl)phenyl]ethanamide: S213 (= S270), F227 (≠ Y282), M256 (= M307)
- binding flavin-adenine dinucleotide: R83 (= R151), A84 (≠ S152), Y85 (= Y153), S86 (= S154), A104 (vs. gap), T105 (vs. gap), P106 (vs. gap), P107 (vs. gap), A113 (≠ L170), P114 (= P171), P115 (≠ D172), G116 (= G173), I117 (≠ V174), M118 (= M175), S119 (= S176), F279 (= F330)
Sites not aligning to the query:
7qtyA X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
25% identity, 54% coverage: 151:330/335 of query aligns to 83:279/279 of 7qtyA
- binding 1-(furan-2-ylmethyl)-3-(2-methylphenyl)thiourea: A184 (≠ V241), R185 (= R242), S213 (= S270), F227 (≠ Y282), H229 (≠ T284), V255 (≠ P306), M256 (= M307)
- binding flavin-adenine dinucleotide: R83 (= R151), A84 (≠ S152), Y85 (= Y153), S86 (= S154), N100 (≠ L166), A104 (vs. gap), T105 (vs. gap), P107 (vs. gap), A113 (≠ L170), P114 (= P171), G116 (= G173), I117 (≠ V174), M118 (= M175), S119 (= S176), F279 (= F330)
Sites not aligning to the query:
Query Sequence
>GFF4631 FitnessBrowser__WCS417:GFF4631
MNHKVAFSFADGKTLFFPVGANEILLDAALRNGIKIPLDCREGVCGTCQGRCESGDYSQD
YVDEEALSSLDLQQRKMLSCQTRVKSDATFYFDFDSSLCNAPGPVQVKGTVSAVEQVSAS
TAILQVQLDQALDFLPGQYARLSVPGTDSWRSYSFANLPGNHLQFLVRLLPDGVMSNYLR
ERCQVGDELLMEAPLGAFYLRHVTQPLVLVAGGTGLSALLGMLDQLAANGCEQPVHLYYG
VRGAEDLCEAARIRAYAAKIPNLRYTEVLSAPSEEWSGKRGYLTEHFDLAELRDGSADMY
LCGPPPMVESIQQWLADQALDGVQLYYEKFTQSNI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory