Comparing GFF4660 FitnessBrowser__WCS417:GFF4660 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 97% coverage: 4:251/255 of query aligns to 14:261/265 of P07821
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
35% identity, 88% coverage: 14:237/255 of query aligns to 12:231/231 of 1l7vC
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
34% identity, 89% coverage: 14:239/255 of query aligns to 12:233/248 of 4fi3C
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 92% coverage: 1:235/255 of query aligns to 2:233/240 of 6mjpA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 89% coverage: 1:226/255 of query aligns to 1:224/240 of 4ymuJ
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
32% identity, 85% coverage: 12:228/255 of query aligns to 330:542/865 of O65934
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 80% coverage: 12:215/255 of query aligns to 16:217/280 of 5x40A
Sites not aligning to the query:
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 84% coverage: 1:215/255 of query aligns to 84:313/345 of Q9AT00
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
31% identity, 87% coverage: 14:235/255 of query aligns to 15:233/233 of 6b8bA
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
31% identity, 87% coverage: 14:235/255 of query aligns to 15:233/235 of 6mhzA
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
31% identity, 87% coverage: 14:235/255 of query aligns to 15:233/234 of 6b89A
Sites not aligning to the query:
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
31% identity, 87% coverage: 14:235/255 of query aligns to 15:233/234 of 4p31A
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
31% identity, 87% coverage: 14:235/255 of query aligns to 15:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
31% identity, 87% coverage: 14:235/255 of query aligns to 15:233/238 of 6s8gA
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
29% identity, 89% coverage: 1:227/255 of query aligns to 1:217/348 of 3d31A
Sites not aligning to the query:
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
30% identity, 94% coverage: 1:239/255 of query aligns to 1:238/276 of Q5M243
6mbnA Lptb e163q in complex with atp (see paper)
30% identity, 87% coverage: 14:235/255 of query aligns to 16:234/241 of 6mbnA
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 88% coverage: 1:225/255 of query aligns to 4:228/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
30% identity, 88% coverage: 1:225/255 of query aligns to 4:228/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
30% identity, 88% coverage: 1:225/255 of query aligns to 2:226/253 of 6z5uK
>GFF4660 FitnessBrowser__WCS417:GFF4660
MLRVEDLQIRRGHKTVLADVTLDLLPGEVLGVLGPNGAGKSTLLGGLCGELHPDQGKVWL
DQRPLNEWSGAQRAQRLAVLPQSSTLDFAFRVEEVVGMGRLPHQTGRVRDDEIIEAALQA
ADVGHLSGRSYLALSGGERQRVHLARVLAQLWPGEAGQTLLLDEPTSMLDPLHQHTTLQA
IRTFADRGAAVLVILHDLNLAARYCDRILLLEAGRPHALDTPAQVMQPEPLKAVFGLDVL
VQPHPERGHPLIIAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory