Comparing GFF47 FitnessBrowser__Marino:GFF47 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
38% identity, 81% coverage: 48:281/288 of query aligns to 47:277/277 of 6iymA
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
35% identity, 78% coverage: 56:279/288 of query aligns to 78:302/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
35% identity, 78% coverage: 56:279/288 of query aligns to 77:301/303 of 8skyB
O06724 Oxaloacetate tautomerase YisK; Oxaloacetate decarboxylase YisK; EC 5.3.2.2; EC 4.1.1.112 from Bacillus subtilis (strain 168) (see paper)
35% identity, 78% coverage: 56:279/288 of query aligns to 77:301/301 of O06724
Sites not aligning to the query:
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
39% identity, 79% coverage: 52:278/288 of query aligns to 47:247/252 of 3qdfA
Q1NEI7 2,4-didehydro-3-deoxy-L-rhamnonate hydrolase; L-2,4-diketo-3-deoxyrhamnonate hydrolase; L-DKDR hydrolase; SpLRA6; EC 3.7.1.26 from Sphingomonas sp. (strain SKA58) (see paper)
33% identity, 97% coverage: 1:280/288 of query aligns to 1:275/285 of Q1NEI7
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
37% identity, 75% coverage: 65:280/288 of query aligns to 66:280/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
37% identity, 75% coverage: 65:280/288 of query aligns to 66:280/290 of 8gsrA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
37% identity, 71% coverage: 68:272/288 of query aligns to 67:269/279 of 6v77B
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
33% identity, 82% coverage: 42:278/288 of query aligns to 35:266/269 of 4dbhA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
31% identity, 84% coverage: 34:276/288 of query aligns to 40:274/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
31% identity, 84% coverage: 34:276/288 of query aligns to 40:274/280 of 6j5xA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
31% identity, 76% coverage: 57:275/288 of query aligns to 50:257/265 of 3r6oA
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
33% identity, 72% coverage: 70:275/288 of query aligns to 12:210/216 of 6sbiA
Q8R0F8 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Acylpyruvate hydrolase; ApH; Fumarylacetoacetate hydrolase domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Mus musculus (Mouse) (see paper)
33% identity, 72% coverage: 70:275/288 of query aligns to 15:213/221 of Q8R0F8
P76004 Oxaloacetate tautomerase YcgM; EC 5.3.2.2 from Escherichia coli (strain K12)
34% identity, 70% coverage: 68:270/288 of query aligns to 15:211/219 of P76004
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
32% identity, 71% coverage: 70:274/288 of query aligns to 13:210/218 of 6fogA
Q6P587 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; YisK-like protein; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 4 papers)
32% identity, 71% coverage: 70:274/288 of query aligns to 15:212/221 of Q6P587
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
29% identity, 72% coverage: 68:274/288 of query aligns to 22:226/233 of 6j5yA
1gttA Crystal structure of hpce (see paper)
33% identity, 64% coverage: 67:251/288 of query aligns to 220:392/421 of 1gttA
>GFF47 FitnessBrowser__Marino:GFF47
MKLARFSYKGSVPAWGVVDLEHQEINPIKERFEDWAPLVTAGAGISAVSFSSGPLAIKEV
TLLPPIEPVNRVVVAGANYLKHLKDDFSLEPPKQPIAFLKAYGALIGADDPIRFPPLTEE
LDYEVELVVVIGSKEVDTTKPYDSVLGYTVGNDVSARDLQRSGPKGIGMDLFAAKSQDKT
TGLGPWIVTRDEFPEGMPALRLTLSVNGEVRQDGNTSEMTWTVAELITFVHERSSFACGD
VLFTGSPAGVGMATGRFLNPGDVVEASVEGVGTLRNVVGERSNKRLGK
Or try a new SitesBLAST search
SitesBLAST's database