SitesBLAST
Comparing GFF476 FitnessBrowser__Phaeo:GFF476 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
71% identity, 93% coverage: 17:402/417 of query aligns to 1:383/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H97), K82 (= K98), Q109 (= Q125), S185 (≠ T201), G227 (= G245), G229 (= G247), S230 (= S248), N231 (= N249), E345 (= E364), S371 (≠ C390), G372 (= G391)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
59% identity, 94% coverage: 13:406/417 of query aligns to 10:403/405 of 6u6cB
- active site: K98 (= K98), E120 (= E120), S387 (≠ C390)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H97), K98 (= K98), T121 (= T121), G122 (= G122), A123 (= A123), Q125 (= Q125), H126 (= H126), T201 (= T201), G243 (= G245), G245 (= G247), S246 (= S248), N247 (= N249), G314 (= G317), E361 (= E364), S387 (≠ C390)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (≠ F26), F185 (≠ L185), W188 (= W188), Y197 (= Y197), F199 (≠ I199), G204 (= G204), P205 (= P205), H291 (= H294), G292 (= G295)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
59% identity, 94% coverage: 13:406/417 of query aligns to 9:402/404 of 6usaB
- active site: K97 (= K98), E119 (= E120), S386 (≠ C390)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H97), K97 (= K98), T120 (= T121), G121 (= G122), A122 (= A123), G123 (= G124), Q124 (= Q125), H125 (= H126), T200 (= T201), G242 (= G245), G244 (= G247), S245 (= S248), N246 (= N249), G313 (= G317), E360 (= E364), S386 (≠ C390)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ L185), W187 (= W188), Y196 (= Y197), F198 (≠ I199), G203 (= G204), P204 (= P205), F207 (≠ Y208), H290 (= H294), G291 (= G295)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
59% identity, 94% coverage: 13:406/417 of query aligns to 9:402/404 of 6dweB
- active site: K97 (= K98), E119 (= E120), S386 (≠ C390)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ L185), Y196 (= Y197), F198 (≠ I199), P204 (= P205), F207 (≠ Y208), H290 (= H294)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H97), K97 (= K98), T120 (= T121), G121 (= G122), A122 (= A123), G123 (= G124), Q124 (= Q125), H125 (= H126), T200 (= T201), G242 (= G245), G244 (= G247), S245 (= S248), N246 (= N249), G313 (= G317), E360 (= E364), S386 (≠ C390)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
59% identity, 94% coverage: 13:406/417 of query aligns to 5:398/399 of 5ocwB
- active site: K93 (= K98), E115 (= E120), S382 (≠ C390)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H97), K93 (= K98), T116 (= T121), G117 (= G122), A118 (= A123), Q120 (= Q125), H121 (= H126), T196 (= T201), G238 (= G245), G240 (= G247), S241 (= S248), N242 (= N249), G309 (= G317), E356 (= E364), S382 (≠ C390)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
59% identity, 94% coverage: 13:406/417 of query aligns to 9:402/405 of 6uapB
- active site: K97 (= K98), E119 (= E120), S386 (≠ C390)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ M181), N181 (= N182), F184 (≠ L185), Y196 (= Y197), F198 (≠ I199), P204 (= P205), F207 (≠ Y208), H290 (= H294)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
59% identity, 94% coverage: 13:406/417 of query aligns to 10:403/406 of 5tciH
- active site: K98 (= K98), E120 (= E120), S387 (≠ C390)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (≠ S28), L31 (= L31), Y197 (= Y197), F199 (≠ I199), P205 (= P205), F208 (≠ Y208), H291 (= H294)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
59% identity, 92% coverage: 19:402/417 of query aligns to 3:383/388 of 5dw0A
- active site: K82 (= K98), E104 (= E120), S371 (≠ C390)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H97), K82 (= K98), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), S185 (≠ T201), G227 (= G245), G229 (= G247), S230 (= S248), N231 (= N249), G298 (= G317), D300 (= D319), E345 (= E364), S371 (≠ C390)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
59% identity, 92% coverage: 19:402/417 of query aligns to 3:383/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
59% identity, 92% coverage: 19:402/417 of query aligns to 3:383/386 of 1v8zA
- active site: K82 (= K98), E104 (= E120), S371 (≠ C390)
- binding pyridoxal-5'-phosphate: H81 (= H97), K82 (= K98), Q109 (= Q125), S185 (≠ T201), G227 (= G245), G228 (= G246), G229 (= G247), S230 (= S248), N231 (= N249), E345 (= E364), S371 (≠ C390), G372 (= G391)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
59% identity, 92% coverage: 19:402/417 of query aligns to 3:383/385 of 6am8B
- active site: K82 (= K98), E104 (= E120), S371 (≠ C390)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H97), K82 (= K98), E104 (= E120), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), L161 (= L177), S185 (≠ T201), V187 (≠ A203), G227 (= G245), G228 (= G246), G229 (= G247), S230 (= S248), N231 (= N249), G298 (= G317), Y301 (= Y320), E345 (= E364), S371 (≠ C390), G372 (= G391)
- binding tryptophan: P12 (≠ S28), L169 (= L185), S274 (≠ L293), H275 (= H294)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
59% identity, 92% coverage: 19:402/417 of query aligns to 3:383/384 of 7rnpA
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
59% identity, 92% coverage: 19:402/417 of query aligns to 3:382/383 of 5dw3A
- active site: K82 (= K98), E104 (= E120), S370 (≠ C390)
- binding tryptophan: K82 (= K98), E104 (= E120), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), S185 (≠ T201), G228 (= G246), Y300 (= Y320)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
59% identity, 92% coverage: 19:402/417 of query aligns to 3:383/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H97), K82 (= K98), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), S185 (≠ T201), G227 (= G245), G229 (= G247), S230 (= S248), N231 (= N249), G298 (= G317), E345 (= E364), S371 (≠ C390)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
59% identity, 92% coverage: 19:402/417 of query aligns to 3:383/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H97), K82 (= K98), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), S185 (≠ T201), G227 (= G245), G229 (= G247), S230 (= S248), N231 (= N249), G298 (= G317), E345 (= E364), S371 (≠ C390)
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
59% identity, 92% coverage: 19:402/417 of query aligns to 3:381/383 of 5t6mA
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
59% identity, 92% coverage: 19:402/417 of query aligns to 3:381/394 of 5ixjD
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
59% identity, 92% coverage: 19:402/417 of query aligns to 3:381/383 of 5vm5D
- active site: K82 (= K98), E104 (= E120), S369 (≠ C390)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H97), K82 (= K98), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), S185 (≠ T201), G227 (= G245), G229 (= G247), S230 (= S248), N231 (= N249), G296 (= G317), E343 (= E364), S369 (≠ C390)
1a50B Crystal structure of wild-type tryptophan synthase complexed with 5- fluoroindole propanol phosphate (see paper)
59% identity, 92% coverage: 19:400/417 of query aligns to 8:386/390 of 1a50B
- active site: K86 (= K98), E108 (= E120), T109 (= T121), T189 (= T201), G231 (= G245), G232 (= G246), G233 (= G247), S234 (= S248), N235 (= N249), S350 (≠ P365), S376 (≠ C390)
- binding pyridoxal-5'-phosphate: H85 (= H97), K86 (= K98), T189 (= T201), G231 (= G245), G232 (= G246), G233 (= G247), S234 (= S248), N235 (= N249), E349 (= E364), S376 (≠ C390), G377 (= G391)
2clfB Tryptophan synthase in complex with n-(4'- trifluoromethoxybenzoyl)-2-amino-1-ethylphosphate (f6) - highf6 complex (see paper)
59% identity, 92% coverage: 19:400/417 of query aligns to 8:386/394 of 2clfB
- active site: K86 (= K98), E108 (= E120), S376 (≠ C390)
- binding 2-{[4-(trifluoromethoxy)benzoyl]amino}ethyl dihydrogen phosphate: P17 (≠ S28), E108 (= E120), T109 (= T121), G110 (= G122), H114 (= H126), L165 (= L177), C169 (≠ M181), L187 (≠ I199), G188 (= G200), T189 (= T201), F279 (≠ H294)
- binding pyridoxal-5'-phosphate: H85 (= H97), K86 (= K98), T189 (= T201), G231 (= G245), G232 (= G246), G233 (= G247), S234 (= S248), N235 (= N249), E349 (= E364), S376 (≠ C390), G377 (= G391)
Sites not aligning to the query:
Query Sequence
>GFF476 FitnessBrowser__Phaeo:GFF476
MAEDLFNSFMNGPDEQGRFGIFGGRFVSETLMPLILSLEEEYDRAKDDPSFWAEMDDLWK
NYVGRPSPLYFAERLTEHLGGAKIYLKRDELNHTGAHKINNVLGQILLARRMGKDRIIAE
TGAGQHGVATATVCAKFGLKCVVYMGAHDVQRQAPNVFRMRLLGAEVIPVTSGRGTLKDA
MNDALRDWVTNVHDTFYCIGTVAGPHPYPAMVRDFQSVIGKEVRWQLAEQEGEGRLPDTV
IAAIGGGSNAMGLFYPFLDDKSVNIIGVEAGGKGVDEKMQHCASLTGGRPGVLHGNRTYL
LQDDDGQILEGFSISAGLDYPGIGPEHAWLNDIGRADYVSITDKEALEAFQLSCAMEGII
PALEPSHALAHVMKIAPDLPKDHIIVMNMCGRGDKDIFTVARHLGFDMSDTEGRDSD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory