SitesBLAST
Comparing GFF485 FitnessBrowser__psRCH2:GFF485 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3fpcA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-294 of t. Brockii adh by e. Histolytica adh (see paper)
37% identity, 98% coverage: 4:352/357 of query aligns to 1:346/352 of 3fpcA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), T92 (≠ S94), V95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
3fsrA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of t. Brockii adh by c. Beijerinckii adh (see paper)
37% identity, 98% coverage: 4:352/357 of query aligns to 1:346/352 of 3fsrA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), T92 (≠ S94), V95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
1ykfA NADP-dependent alcohol dehydrogenase from thermoanaerobium brockii (see paper)
36% identity, 98% coverage: 4:352/357 of query aligns to 1:346/352 of 1ykfA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), T92 (≠ S94), V95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (≠ T42), D150 (= D159), T154 (= T163), G174 (≠ A183), I175 (≠ Q184), G176 (= G185), P177 (= P186), V178 (≠ I187), S199 (≠ G208), R200 (≠ V209), Y218 (≠ F227), I223 (≠ V232), N266 (≠ G275), Y267 (≠ V276)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
1bxzB Crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii (see paper)
36% identity, 98% coverage: 4:352/357 of query aligns to 1:346/352 of 1bxzB
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), T92 (≠ S94), V95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding 2-butanol: H59 (= H61), D150 (= D159)
P14941 NADP-dependent isopropanol dehydrogenase; EC 1.1.1.80 from Thermoanaerobacter brockii (Thermoanaerobium brockii) (see 2 papers)
36% identity, 98% coverage: 4:352/357 of query aligns to 1:346/352 of P14941
7f3pD Crystal structure of a NADP-dependent alcohol dehydrogenase mutant in apo form (see paper)
35% identity, 98% coverage: 4:352/357 of query aligns to 4:349/355 of 7f3pD
1y9aA Alcohol dehydrogenase from entamoeba histolotica in complex with cacodylate (see paper)
37% identity, 99% coverage: 4:356/357 of query aligns to 1:350/360 of 1y9aA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), E92 (≠ S94), S95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding acetate ion: P24 (= P27), G69 (= G71), S70 (= S72)
- binding cacodylate ion: S39 (≠ T42), H59 (= H61), W110 (= W119), D150 (= D159)
- binding 1,2-ethanediol: G98 (= G100), Y99 (≠ L101), M101 (≠ S103), H157 (≠ A166)
- binding zinc ion: C37 (= C40), D51 (≠ V53), H53 (≠ A55), H59 (= H61), D150 (= D159)
P35630 NADP-dependent isopropanol dehydrogenase; EhADH1; EC 1.1.1.80 from Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) (see paper)
37% identity, 99% coverage: 4:356/357 of query aligns to 7:356/366 of P35630
- C43 (= C40) binding
- H65 (= H61) binding
- E66 (= E62) binding
- D156 (= D159) binding
2ouiA D275p mutant of alcohol dehydrogenase from protozoa entamoeba histolytica (see paper)
37% identity, 99% coverage: 4:356/357 of query aligns to 1:350/360 of 2ouiA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), E92 (≠ S94), S95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
7uutA Ternary complex crystal structure of secondary alcohol dehydrogenases from the thermoanaerobacter ethanolicus mutants c295a and i86a provides better understanding of catalytic mechanism (see paper)
35% identity, 98% coverage: 4:352/357 of query aligns to 1:346/352 of 7uutA
- binding (2R)-pentan-2-ol: S39 (≠ T42), H59 (= H61), A85 (= A87), W110 (= W119), D150 (= D159), C295 (= C302)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C37 (= C40), T38 (≠ G41), S39 (≠ T42), D150 (= D159), T154 (= T163), G174 (≠ A183), G176 (= G185), P177 (= P186), V178 (≠ I187), S199 (≠ G208), R200 (≠ V209), A242 (= A251), G243 (≠ L252), G244 (= G253), I248 (≠ T257), V265 (≠ L274), N266 (≠ G275), Y267 (≠ V276), C295 (= C302), K340 (≠ Q346)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
7ux4A Crystallographic snapshots of ternary complexes of thermophilic secondary alcohol dehydrogenase from thermoanaerobacter pseudoethanolicus reveal the dynamics of ligand exchange and the proton relay network. (see paper)
36% identity, 95% coverage: 13:352/357 of query aligns to 8:344/350 of 7ux4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D148 (= D159), T152 (= T163), G172 (≠ A183), I173 (≠ Q184), G174 (= G185), P175 (= P186), V176 (≠ I187), R198 (≠ V209), G242 (= G253), V263 (≠ L274), N264 (≠ G275), Y265 (≠ V276), C293 (= C302)
- binding (1S,3S)-3-methylcyclohexan-1-ol: S37 (≠ T42), H57 (= H61), W108 (= W119), D148 (= D159)
- binding zinc ion: C35 (= C40), H57 (= H61), E58 (= E62), D148 (= D159)
7xy9A Cryo-em structure of secondary alcohol dehydrogenases tbsadh after carrier-free immobilization based on weak intermolecular interactions
36% identity, 95% coverage: 13:352/357 of query aligns to 11:339/344 of 7xy9A
- binding magnesium ion: H101 (≠ P102), H103 (≠ Q104), H158 (≠ A166), C288 (= C302), G290 (= G304), G291 (= G305), L293 (≠ E307), R294 (= R308)
- binding zinc ion: C38 (= C40), H60 (= H61), E61 (= E62), D151 (= D159)
1kevA Structure of NADP-dependent alcohol dehydrogenase (see paper)
36% identity, 99% coverage: 4:355/357 of query aligns to 1:349/351 of 1kevA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), S92 (= S94), V95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T38 (≠ G41), D150 (= D159), I175 (≠ Q184), G176 (= G185), V178 (≠ I187), S199 (≠ G208), R200 (≠ V209), Y218 (≠ F227), A242 (= A251), G244 (= G253), N266 (≠ G275), Y267 (≠ V276), K340 (≠ Q346)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
P25984 NADP-dependent isopropanol dehydrogenase; CbADH; EC 1.1.1.80 from Clostridium beijerinckii (Clostridium MP) (see 3 papers)
36% identity, 99% coverage: 4:355/357 of query aligns to 1:349/351 of P25984
6schC Nadh-dependent variant of cbadh (see paper)
36% identity, 99% coverage: 4:355/357 of query aligns to 1:349/355 of 6schC
- active site: C37 (= C40), S39 (≠ T42), H42 (= H45), H59 (= H61), D150 (= D159)
- binding nicotinamide-adenine-dinucleotide: T38 (≠ G41), W110 (= W119), D150 (= D159), T154 (= T163), G174 (≠ A183), V178 (≠ I187), D198 (= D207), Y199 (≠ G208), R200 (≠ V209), A242 (= A251), G243 (≠ L252), G244 (= G253), N266 (≠ G275), Y267 (≠ V276), K340 (≠ Q346)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
3fplA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of c. Beijerinckii adh by t. Brockii adh (see paper)
34% identity, 99% coverage: 4:355/357 of query aligns to 1:349/351 of 3fplA
- active site: C37 (= C40), T38 (≠ G41), S39 (≠ T42), H42 (= H45), H59 (= H61), E60 (= E62), D89 (≠ S91), S92 (= S94), V95 (≠ C97), S103 (≠ D105), D150 (= D159), T154 (= T163), K346 (= K352)
- binding zinc ion: C37 (= C40), H59 (= H61), D150 (= D159)
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
33% identity, 100% coverage: 1:356/357 of query aligns to 2:342/348 of 5ylnA
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
32% identity, 99% coverage: 4:355/357 of query aligns to 1:343/346 of 4cpdA
- active site: C38 (= C40), G39 (= G41), S40 (≠ T42), H43 (= H45), H59 (= H61), E60 (= E62), C89 (≠ G86), C92 (= C89), C95 (≠ F92), C103 (= C97), G107 (≠ S109), D152 (= D159), T156 (= T163), K340 (= K352)
- binding nicotinamide-adenine-dinucleotide: G39 (= G41), S40 (≠ T42), T156 (= T163), G178 (= G185), P179 (= P186), V180 (≠ I187), D200 (= D207), R201 (≠ G208), R205 (= R212), A243 (= A251), V244 (≠ L252), V266 (≠ L274), V268 (= V276), L292 (= L292), A293 (≠ G293), F333 (= F343)
- binding zinc ion: C38 (= C40), H59 (= H61), C89 (≠ G86), C92 (= C89), C95 (≠ F92), C103 (= C97), D152 (= D159)
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
30% identity, 100% coverage: 2:357/357 of query aligns to 2:342/342 of 4ejmA
- active site: C40 (= C40), G41 (= G41), T42 (= T42), H45 (= H45), H61 (= H61), E62 (= E62), C91 (≠ G86), C94 (= C89), C97 (= C97), C105 (= C110), R109 (≠ K114), P147 (≠ I160), C151 (≠ G164), K337 (= K352)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (≠ A183), G172 (= G185), V173 (≠ P186), I174 (= I187), T194 (≠ D207), R195 (≠ G208), Q196 (≠ V209), K199 (≠ R212), C240 (≠ A251), E245 (≠ S256), T246 (= T257), L263 (= L274), V265 (= V276), I291 (≠ C302)
- binding zinc ion: C91 (≠ G86), C94 (= C89), C97 (= C97), C105 (= C110)
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
30% identity, 100% coverage: 2:357/357 of query aligns to 2:342/343 of 4ej6A
- active site: C40 (= C40), G41 (= G41), T42 (= T42), H45 (= H45), H61 (= H61), E62 (= E62), C91 (≠ G86), C94 (= C89), C97 (= C97), C105 (= C110), R109 (≠ K114), P147 (≠ I160), C151 (≠ G164), K337 (= K352)
- binding zinc ion: C91 (≠ G86), C94 (= C89), C97 (= C97), C105 (= C110)
Query Sequence
>GFF485 FitnessBrowser__psRCH2:GFF485
MAMMKAAVFVEPGRIELQDKPIPEIGPNDALLRITTTTICGTDVHILKGEYPVAAGLTIG
HEPVGVIEKLGSNVKGYQEGQRVIAGAICPSFTSYACQDGLPSQDGGCSCHGYKPMGGWR
FGNTIDGTQAEYVLVPDAQANLAPVPDGLTDEQVLMCPDIMSTGFAGAEAANIKIGDIVV
IFAQGPIGLCATAGAKLRGASTIIAVDGVDARLDIARKMGADVTLNFRNVDVVDEVLKLT
SGRGADASIEALGLQSTFESALRVLKPGGTLSSLGVYSSDLTIPLGAFHAGLGDNKIVTS
LCPGGKERMRRLLNVVASGRVDLGLLVTHKYALDNITDAYDLFANQRDGVLKVAIKP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory