Comparing GFF5033 FitnessBrowser__WCS417:GFF5033 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q88QT2 N-acetylmuramate alpha-1-phosphate uridylyltransferase; MurNAc-1P uridylyltransferase; MurNAc-alpha-1P uridylyltransferase; EC 2.7.7.99 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
75% identity, 98% coverage: 1:220/224 of query aligns to 1:219/223 of Q88QT2
4y7uA Structural analysis of muru (see paper)
75% identity, 98% coverage: 1:220/224 of query aligns to 1:219/224 of 4y7uA
4y7vA Structural analysis of muru (see paper)
73% identity, 98% coverage: 1:220/224 of query aligns to 1:214/216 of 4y7vA
7d73E Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
30% identity, 93% coverage: 1:208/224 of query aligns to 1:220/360 of 7d73E
7d72K Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
30% identity, 93% coverage: 1:208/224 of query aligns to 1:220/360 of 7d72K
7d72E Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
30% identity, 93% coverage: 1:208/224 of query aligns to 1:220/360 of 7d72E
P74285 UTP--glucose-1-phosphate uridylyltransferase; Cyanobacterial UDP-glucose pyrophosphorylase; UDP-glucose pyrophosphorylase; UDP-Glc PPase; EC 2.7.7.9 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
38% identity, 59% coverage: 1:133/224 of query aligns to 1:147/388 of P74285
7x8kB Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
38% identity, 52% coverage: 1:117/224 of query aligns to 1:121/367 of 7x8kB
7x8kA Arabidopsis gdp-d-mannose pyrophosphorylase (vtc1) structure (product- bound) (see paper)
38% identity, 52% coverage: 1:117/224 of query aligns to 1:121/365 of 7x8kA
Sites not aligning to the query:
O22287 Mannose-1-phosphate guanylyltransferase 1; GDP-mannose pyrophosphorylase 1; Protein CYTOKINESIS DEFECTIVE 1; Protein EMBRYO DEFECTIVE 101; Protein HYPERSENSITIVE TO AMMONIUM ION 1; Protein SENSITIVE TO OZONE 1; Protein VITAMIN C DEFECTIVE 1; EC 2.7.7.13 from Arabidopsis thaliana (Mouse-ear cress) (see 5 papers)
38% identity, 52% coverage: 1:117/224 of query aligns to 1:121/361 of O22287
Sites not aligning to the query:
7whtA Cryo-em structure of leishmanial gdp-mannose pyrophosphorylase in complex with gdp-mannose (see paper)
36% identity, 52% coverage: 1:117/224 of query aligns to 1:120/360 of 7whtA
Sites not aligning to the query:
7whsA Cryo-em structure of leishmanial gdp-mannose pyrophosphorylase in complex with gtp (see paper)
36% identity, 52% coverage: 1:117/224 of query aligns to 1:120/366 of 7whsA
Sites not aligning to the query:
1jylA Catalytic mechanism of ctp:phosphocholine cytidylyltransferase from streptococcus pneumoniae (licc) (see paper)
40% identity, 44% coverage: 1:99/224 of query aligns to 3:94/228 of 1jylA
Sites not aligning to the query:
7d73B Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
36% identity, 52% coverage: 1:117/224 of query aligns to 2:126/406 of 7d73B
Sites not aligning to the query:
7d72A Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
36% identity, 52% coverage: 1:117/224 of query aligns to 2:126/407 of 7d72A
Sites not aligning to the query:
6jq8A Crystal structure of hddc from yersinia pseudotuberculosis complexed with gmp-pn (see paper)
26% identity, 93% coverage: 3:211/224 of query aligns to 4:215/225 of 6jq8A
3hl3A 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose.
28% identity, 98% coverage: 1:219/224 of query aligns to 2:233/246 of 3hl3A
4ecmA 2.3 angstrom crystal structure of a glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with thymidine-5-diphospho-alpha-d-glucose and pyrophosphate (see paper)
28% identity, 98% coverage: 1:219/224 of query aligns to 3:234/245 of 4ecmA
3pkqA Q83d variant of s. Enterica rmla with dgtp (see paper)
25% identity, 98% coverage: 2:220/224 of query aligns to 3:235/285 of 3pkqA
1lvwA Crystal structure of glucose-1-phosphate thymidylyltransferase, rmla, complex with dtdp
32% identity, 53% coverage: 1:119/224 of query aligns to 4:124/295 of 1lvwA
Sites not aligning to the query:
>GFF5033 FitnessBrowser__WCS417:GFF5033
MKAMILAAGKGERMRPLTLHTPKPLVQAGGKRLIEYHLEALAKAGFTDIVINHAWLGQQI
ENYLGDGAQFGLRIRYSPEGEPLETGGGIFQALPLLGDEPFLVVNGDIWTDYDFTQLKRP
LKGLAHLVMVDNPAHHPSDGDFYLDQGLLHDAAPGADNLTFSGISVLDPKLFEGCSAGAF
KLAPLLRAAMAKGLVTGEHMIGRWIDVGTLERLAQVETLLTAGQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory