Comparing GFF5075 FitnessBrowser__WCS417:GFF5075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1djeA Crystal structure of the plp-bound form of 8-amino-7-oxonanoate synthase (see paper)
45% identity, 95% coverage: 5:378/393 of query aligns to 6:379/383 of 1djeA
1dj9A Crystal structure of 8-amino-7-oxonanoate synthase (or 7-keto- 8aminipelargonate or kapa synthase) complexed with plp and the product 8(s)-amino-7-oxonanonoate (or kapa). The enzyme of biotin biosynthetic pathway. (see paper)
45% identity, 95% coverage: 5:378/393 of query aligns to 6:379/383 of 1dj9A
P12998 8-amino-7-oxononanoate synthase; AONS; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; EC 2.3.1.47 from Escherichia coli (strain K12) (see 2 papers)
47% identity, 89% coverage: 29:378/393 of query aligns to 31:380/384 of P12998
Sites not aligning to the query:
2g6wA Suicide inhibition of a-oxamine synthase: structures of the covalent adducts of 8-amino-7-oxonanoate synthase with trifluoroalanine (see paper)
47% identity, 89% coverage: 29:378/393 of query aligns to 30:379/383 of 2g6wA
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
42% identity, 97% coverage: 2:384/393 of query aligns to 5:390/398 of 7poaA
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
37% identity, 92% coverage: 17:378/393 of query aligns to 20:386/396 of 3tqxA
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
37% identity, 96% coverage: 9:384/393 of query aligns to 13:390/398 of P0AB77
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
37% identity, 97% coverage: 5:384/393 of query aligns to 12:393/401 of 1fc4A
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
36% identity, 96% coverage: 13:389/393 of query aligns to 19:393/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
36% identity, 96% coverage: 13:389/393 of query aligns to 19:393/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
36% identity, 96% coverage: 13:389/393 of query aligns to 19:393/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
36% identity, 96% coverage: 13:389/393 of query aligns to 19:393/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
36% identity, 96% coverage: 13:389/393 of query aligns to 19:393/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
36% identity, 96% coverage: 13:389/393 of query aligns to 19:393/394 of 8guhA
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
36% identity, 96% coverage: 13:389/393 of query aligns to 19:397/400 of 7v58B
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
36% identity, 95% coverage: 13:384/393 of query aligns to 19:388/392 of 3a2bA
Q0P5L8 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; AKB ligase; Aminoacetone synthase; Glycine acetyltransferase; EC 2.3.1.29 from Bos taurus (Bovine) (see paper)
36% identity, 95% coverage: 5:378/393 of query aligns to 31:408/419 of Q0P5L8
Sites not aligning to the query:
Q5W264 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH; HBM synthase; Aminotransferase PigH; EC 2.3.2.- from Serratia sp. (strain ATCC 39006) (see paper)
37% identity, 90% coverage: 37:388/393 of query aligns to 285:642/653 of Q5W264
Sites not aligning to the query:
Q8GW43 8-amino-7-oxononanoate synthase; AONS; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; Biotin synthase 4; Biotin synthase F; AtbioF; EC 2.3.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 92% coverage: 20:382/393 of query aligns to 74:459/476 of Q8GW43
Sites not aligning to the query:
7bxsA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form
36% identity, 94% coverage: 9:378/393 of query aligns to 15:389/399 of 7bxsA
>GFF5075 FitnessBrowser__WCS417:GFF5075
MSFDLAARLAARRAEHLYRQRPLLDSPQGPEVVVDGQPLLAFCNNDYLGLANHPQVIEAW
RAGASRWGVGGGASHLVVGHATPHHELEEALADFTGRPRALLFTTGYMANLGAVTALVGQ
GDTVLEDRLNHASLLDAGLLSGARFNRYLHNDAESLAKRLEKATGNTLVVTDGVFSMDGD
LADLPALARETKAKGAWLMVDDAHGFGPLGANGGGIVEHFGLSQEDVPVLVGTLGKAFGT
AGAFVAGSEALIESLIQFARPYIYTTSQPPALACATLKSLELLRTEHWRREHLNSLIHQF
RQGAEQLGLDLMDSFTPIQPILIGDSAKAMRLSQMLRERGLMVTAIRPPTVPAGSARLRV
TLTAAHTEAQVRLLLNALEACLRVSSSSEPDHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory