SitesBLAST
Comparing GFF5083 FitnessBrowser__WCS417:GFF5083 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5oasA Crystal structure of malate synthase g from pseudomonas aeruginosa in apo form. (see paper)
85% identity, 100% coverage: 1:725/725 of query aligns to 4:728/728 of 5oasA
5vfbA 1.36 angstrom resolution crystal structure of malate synthase g from pseudomonas aeruginosa in complex with glycolic acid.
85% identity, 100% coverage: 2:725/725 of query aligns to 1:724/724 of 5vfbA
6axeA Crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
66% identity, 100% coverage: 1:724/725 of query aligns to 2:729/729 of 6axeA
- active site: D272 (= D272), E274 (= E274), R338 (= R340), E437 (= E432), D465 (= D460), D636 (= D631)
- binding acetyl coenzyme *a: V119 (= V118), V120 (= V119), R126 (= R125), F127 (= F126), N130 (= N129), A131 (= A130), R311 (= R313), R338 (= R340), M518 (= M513), W544 (= W539), P546 (= P541), P548 (= P543), C622 (= C617), K624 (= K619), M634 (= M629), D636 (= D631)
- binding magnesium ion: E437 (= E432), D465 (= D460)
P9WK16 Malate synthase G; EC 2.3.3.9 from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) (see paper)
66% identity, 100% coverage: 1:722/725 of query aligns to 1:724/741 of P9WK16
- R339 (= R340) active site, Proton acceptor
- D633 (= D631) active site, Proton donor
2gq3A Mycobacterium tuberculosis malate synthase in complex with magnesium, malate, and coenzyme a (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:717/720 of 2gq3A
- active site: D267 (= D272), E269 (= E274), R335 (= R340), E430 (= E432), D458 (= D460), D626 (= D631)
- binding coenzyme a: V114 (= V118), V115 (= V119), R121 (= R125), F122 (= F126), N125 (= N129), A126 (= A130), K301 (= K306), R308 (= R313), P539 (= P541), P541 (= P543), C612 (= C617), M624 (= M629), D626 (= D631)
- binding magnesium ion: H370 (= H375), K373 (≠ N378), N378 (= N380), G379 (≠ S381), L381 (≠ R383), E430 (= E432), D458 (= D460)
6dkoA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-f-phenyldiketoacid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:713/716 of 6dkoA
- active site: D270 (= D272), E272 (= E274), R332 (= R340), E424 (= E432), D452 (= D460), D622 (= D631)
- binding 4-(2,6-difluorophenyl)-2,4-dioxobutanoic acid: R332 (= R340), G449 (= G457), L451 (= L459), D452 (= D460), M505 (= M513), W531 (= W539), M620 (= M629), D622 (= D631)
- binding magnesium ion: E424 (= E432), D452 (= D460)
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:709/712 of 6dnpA
- active site: D270 (= D272), E272 (= E274), R328 (= R340), E419 (= E432), D447 (= D460), D618 (= D631)
- binding (2Z)-4-(2,6-difluoro-3-methylphenyl)-2-hydroxy-4-oxobut-2-enoic acid: R328 (= R340), E419 (= E432), G444 (= G457), L446 (= L459), D447 (= D460), M500 (= M513), W526 (= W539), M616 (= M629), D618 (= D631)
- binding magnesium ion: E419 (= E432), D447 (= D460)
5cbiA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-chloro-2-hydroxybenzonitrile (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:716/719 of 5cbiA
- active site: D270 (= D272), E272 (= E274), R331 (= R340), E426 (= E432), D454 (= D460), D625 (= D631)
- binding 5-chloro-2-hydroxybenzonitrile: L53 (= L54), N54 (≠ A55), D57 (= D58), F125 (= F126), Y138 (= Y139), D139 (= D140), Y142 (= Y143), M507 (= M513), W533 (= W539), P535 (= P541), A611 (≠ C617), M623 (= M629), M623 (= M629), E624 (= E630), D625 (= D631)
- binding magnesium ion: E426 (= E432), D454 (= D460)
5cjmA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4h-thieno[3,2-b]pyrrole-5-carboxylic acid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:708/711 of 5cjmA
- active site: D270 (= D272), E272 (= E274), R328 (= R340), E418 (= E432), D446 (= D460), D617 (= D631)
- binding 4h-thieno[3,2-b]pyrole-5-carboxylic acid: V117 (= V118), S274 (= S276), M499 (= M513), E616 (= E630), D617 (= D631)
- binding magnesium ion: E418 (= E432), D446 (= D460)
5drcA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(1h-indol-3-yl)-4-oxobut-2-enoic acid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:713/716 of 5drcA
- active site: D270 (= D272), E272 (= E274), R330 (= R340), E423 (= E432), D451 (= D460), D622 (= D631)
- binding (2Z)-2-hydroxy-4-(1H-indol-3-yl)-4-oxobut-2-enoic acid: R330 (= R340), E423 (= E432), G448 (= G457), L450 (= L459), D451 (= D460), M504 (= M513), W530 (= W539), M620 (= M629), D622 (= D631)
- binding magnesium ion: E423 (= E432), D451 (= D460), R468 (= R477), T471 (≠ A480)
6bu1A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-3-oh-phenyldiketoacid (see paper)
66% identity, 99% coverage: 3:722/725 of query aligns to 1:709/712 of 6bu1A
- active site: D269 (= D272), E271 (= E274), R327 (= R340), E419 (= E432), D447 (= D460), D618 (= D631)
- binding (2Z)-4-(2-bromo-3-hydroxyphenyl)-2-hydroxy-4-oxobut-2-enoic acid: V116 (= V118), R327 (= R340), E419 (= E432), G444 (= G457), L446 (= L459), D447 (= D460), M500 (= M513), W526 (= W539), M616 (= M629), D618 (= D631)
- binding magnesium ion: E419 (= E432), D447 (= D460), V463 (= V476), R464 (= R477)
5c9rA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-((4-chlorophenyl)thio)propanoic acid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:714/717 of 5c9rA
- active site: D270 (= D272), E272 (= E274), R331 (= R340), E424 (= E432), D452 (= D460), D623 (= D631)
- binding 3-[(4-chlorophenyl)sulfanyl]propanoic acid: V117 (= V118), E424 (= E432), D452 (= D460), M505 (= M513), W531 (= W539), M621 (= M629), D623 (= D631)
- binding magnesium ion: E424 (= E432), D452 (= D460)
6c2xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-6-me-phenyldiketoacid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:708/711 of 6c2xA
- active site: D268 (= D272), E270 (= E274), R328 (= R340), E418 (= E432), D446 (= D460), D617 (= D631)
- binding (2S)-4-(2-bromo-6-methylphenyl)-2-hydroxy-4-oxobutanoic acid: V115 (= V118), R328 (= R340), E418 (= E432), G443 (= G457), L445 (= L459), D446 (= D460), M499 (= M513), W525 (= W539), M615 (= M629), D617 (= D631)
- binding magnesium ion: E418 (= E432), D446 (= D460)
6dl9A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-cl-phenyldiketoacid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:713/716 of 6dl9A
- active site: D270 (= D272), E272 (= E274), R328 (= R340), E423 (= E432), D451 (= D460), D622 (= D631)
- binding 4-(2,6-dichlorophenyl)-2,4-dioxobutanoic acid: V117 (= V118), R328 (= R340), E423 (= E432), G448 (= G457), L450 (= L459), D451 (= D460), M504 (= M513), W530 (= W539), M620 (= M629), D622 (= D631)
- binding magnesium ion: E423 (= E432), D451 (= D460)
5c9xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,4-dichloro-5-fluorobenzoic acid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:713/716 of 5c9xA
- active site: D270 (= D272), E272 (= E274), R328 (= R340), E423 (= E432), D451 (= D460), D622 (= D631)
- binding 2,4-dichloro-5-fluorobenzoic acid: V117 (= V118), S274 (= S276), R328 (= R340), M504 (= M513), W530 (= W539), M620 (= M629), D622 (= D631)
- binding magnesium ion: K295 (= K297), H363 (= H375), K366 (≠ N378), N371 (= N380), G372 (≠ S381), L374 (≠ R383), E423 (= E432), D451 (= D460)
5c7vA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-pyrrole-2-carboxylic acid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:713/716 of 5c7vA
5cakA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-3-(1h-indol-3-yl)propanoic acid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:714/717 of 5cakA
- active site: D270 (= D272), E272 (= E274), R329 (= R340), E424 (= E432), D452 (= D460), D623 (= D631)
- binding (2R)-2-hydroxy-3-(1H-indol-3-yl)propanoic acid: V117 (= V118), L451 (= L459), M505 (= M513), E622 (= E630), D623 (= D631)
- binding magnesium ion: E424 (= E432), D452 (= D460)
6c8pA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-phenyldiketoacid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:713/716 of 6c8pA
- active site: D270 (= D272), E272 (= E274), R329 (= R340), E423 (= E432), D451 (= D460), D622 (= D631)
- binding (2Z)-4-(2-fluorophenyl)-2-hydroxy-4-oxobut-2-enoic acid: R329 (= R340), E423 (= E432), G448 (= G457), L450 (= L459), D451 (= D460), M504 (= M513), W530 (= W539), M620 (= M629), D622 (= D631)
- binding magnesium ion: E423 (= E432), D451 (= D460)
5t8gA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-oxo-4-((thiophene-2-carbonyl)oxy)butanoic acid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:711/714 of 5t8gA
- active site: D270 (= D272), E272 (= E274), R328 (= R340), E421 (= E432), D449 (= D460), D620 (= D631)
- binding (3E)-2-oxo-4-[(thiophen-2-ylcarbonyl)oxy]but-3-enoic acid: V117 (= V118), R328 (= R340), E421 (= E432), G446 (= G457), L448 (= L459), D449 (= D460), M502 (= M513), W528 (= W539), E619 (= E630), D620 (= D631)
- binding magnesium ion: E421 (= E432), D449 (= D460), R466 (= R477), T469 (≠ A480)
5dx7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-(5-chlorothiophen-2-yl)isoxazole-3-carboxylic acid (see paper)
66% identity, 99% coverage: 2:722/725 of query aligns to 1:711/714 of 5dx7A
- active site: D270 (= D272), E272 (= E274), R328 (= R340), E421 (= E432), D449 (= D460), D620 (= D631)
- binding 5-(5-chlorothiophen-2-yl)-1,2-oxazole-3-carboxylic acid: V117 (= V118), M502 (= M513), M618 (= M629), D620 (= D631)
- binding magnesium ion: E421 (= E432), D449 (= D460)
Query Sequence
>GFF5083 FitnessBrowser__WCS417:GFF5083
MTEHVQVGGLQVAKVLFDFVNNEAIPGTGITADQFWAGADKVIHDLAPKNKALLAKRDDF
QARIDTWHQTHAGQAHDPVAYKAFLQDIGYLLPEAADFQATTQNVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDAISEADGAEKGQGYNKVRGDKVIAFARAFLDEAA
PLSAGSHVDSTGYKIVDGKLIVSLKGGSNSGLRDDAQLIGFQGPAAQPIAILLKHNGLHF
EIQIDASTPVGQTDAAGIKDVLMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGDL
AEEVAKGGKTFTRTMNADRVYTGVNGQDVTLHGRSLLFVRNVGHLMTIDAILDKDGNEVP
EGILDGLITSLAAIHSLNGNSSRKNSRTGSVYIVKPKMHGPEEAAFTNELFGRIENVLNL
PRNTLKVGIMDEERRTTVNLKACIKAASERVVFINTGFLDRTGDEIHTSMEAGAMVRKAA
MKAEKWISAYENWNVDIGLSTGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAAALHVLHYHKVDVFARQAELAKRERASVDDILTIPLASNTNWSDEEIRNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHGIVNEVQVMESL
KRMAPVVDRQNAGDKLYRPLAPDFDSNIAFQAAVELVIEGTKQPNGYTEPVLHRRRREFK
AKNGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory