SitesBLAST
Comparing GFF5107 FitnessBrowser__WCS417:GFF5107 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P46154 Glutathione-independent formaldehyde dehydrogenase; FALDH; FDH; Formaldehyde dismutase; EC 1.2.1.46; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
93% identity, 100% coverage: 1:399/399 of query aligns to 1:399/399 of P46154
1kolA Crystal structure of formaldehyde dehydrogenase (see paper)
94% identity, 99% coverage: 3:398/399 of query aligns to 1:396/396 of 1kolA
- active site: C45 (= C47), G46 (= G48), S47 (= S49), H50 (= H52), H66 (= H68), E67 (= E69), C96 (= C98), C99 (= C101), C102 (= C104), C110 (= C112), N114 (= N116), D168 (= D170), T172 (= T174), K385 (= K387)
- binding nicotinamide-adenine-dinucleotide: C45 (= C47), G46 (= G48), S47 (= S49), H50 (= H52), F92 (= F94), D168 (= D170), T172 (= T174), G192 (= G194), G194 (= G196), P195 (= P197), V196 (= V198), D216 (= D218), L217 (≠ V219), R221 (= R223), A260 (≠ C262), V261 (= V263), R266 (= R268), H268 (= H270), V281 (= V283), P298 (= P300), L300 (= L302), Q336 (= Q338), T337 (= T339)
- binding zinc ion: C45 (= C47), H66 (= H68), C96 (= C98), C99 (= C101), C102 (= C104), C110 (= C112), D168 (= D170)
4jlwA Crystal structure of formaldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
89% identity, 99% coverage: 3:396/399 of query aligns to 1:394/395 of 4jlwA
- binding nicotinamide-adenine-dinucleotide: C45 (= C47), G46 (= G48), S47 (= S49), H50 (= H52), D168 (= D170), T172 (= T174), G194 (= G196), P195 (= P197), V196 (= V198), D216 (= D218), R221 (= R223), V261 (= V263), R266 (= R268), H268 (= H270), V281 (= V283), P298 (= P300), L300 (= L302), Q336 (= Q338), T337 (= T339)
- binding zinc ion: C45 (= C47), H66 (= H68), C96 (= C98), C99 (= C101), C102 (= C104), C110 (= C112), D168 (= D170)
Q52078 Formaldehyde dismutase; EC 1.2.98.1 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
59% identity, 99% coverage: 1:397/399 of query aligns to 1:397/399 of Q52078
Sites not aligning to the query:
- 2:399 modified: mature protein, Formaldehyde dismutase
2dphA Crystal structure of formaldehyde dismutase
58% identity, 99% coverage: 2:397/399 of query aligns to 1:396/398 of 2dphA
- active site: C45 (= C47), G46 (= G48), S47 (= S49), H50 (= H52), H66 (= H68), E67 (= E69), C96 (= C98), C99 (= C101), C102 (= C104), C110 (= C112), L114 (vs. gap), S168 (= S169), D169 (= D170), P172 (= P173), K386 (= K387)
- binding nicotinamide-adenine-dinucleotide: C45 (= C47), G46 (= G48), S47 (= S49), H50 (= H52), F92 (= F94), D169 (= D170), T173 (= T174), A192 (= A193), G193 (= G194), G195 (= G196), P196 (= P197), V197 (= V198), G216 (= G217), D217 (= D218), Q218 (≠ V219), R222 (= R223), L236 (= L237), V262 (= V263), H267 (≠ R268), P298 (= P300), G299 (= G301), I300 (≠ L302), A337 (≠ T339)
- binding zinc ion: C45 (= C47), H66 (= H68), C96 (= C98), C99 (= C101), C102 (= C104), C110 (= C112), D169 (= D170)
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
31% identity, 94% coverage: 5:381/399 of query aligns to 2:334/346 of 4cpdA
- active site: C38 (= C47), G39 (= G48), S40 (= S49), H43 (= H52), H59 (= H68), E60 (= E69), C89 (= C98), C92 (= C101), C95 (= C104), C103 (= C112), G107 (= G122), D152 (= D170), T156 (= T174)
- binding nicotinamide-adenine-dinucleotide: G39 (= G48), S40 (= S49), T156 (= T174), G178 (= G196), P179 (= P197), V180 (= V198), D200 (= D218), R201 (≠ V219), R205 (= R223), A243 (= A277), V244 (≠ E278), V266 (≠ P300), V268 (= V311), L292 (≠ Q338), A293 (≠ T339), F333 (= F380)
- binding zinc ion: C38 (= C47), H59 (= H68), C89 (= C98), C92 (= C101), C95 (= C104), C103 (= C112), D152 (= D170)
Sites not aligning to the query:
5ylnA Zinc dependent alcohol dehydrogenase 2 from streptococcus pneumonia - apo form
35% identity, 67% coverage: 1:267/399 of query aligns to 2:246/348 of 5ylnA
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
34% identity, 49% coverage: 37:231/399 of query aligns to 28:208/341 of P07913
- C38 (= C47) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
31% identity, 63% coverage: 15:266/399 of query aligns to 14:250/357 of 7y9pA
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
34% identity, 50% coverage: 37:235/399 of query aligns to 32:216/350 of Q5JI69
- L179 (≠ V198) binding
- E199 (≠ D218) binding
- R204 (= R223) binding
Sites not aligning to the query:
- 266:268 binding
- 291:292 binding
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
34% identity, 50% coverage: 37:235/399 of query aligns to 30:214/347 of 3gfbA
- active site: C40 (= C47), G41 (= G48), T42 (≠ S49), H45 (= H52), H65 (= H68), E66 (= E69), C95 (= C98), C98 (= C101), C101 (= C104), C109 (= C112), K113 (≠ N116), P151 (≠ C167), A155 (≠ I171)
- binding nicotinamide-adenine-dinucleotide: G173 (= G194), G175 (= G196), P176 (= P197), L177 (≠ V198), S196 (≠ G217), E197 (≠ D218), P198 (≠ V219), R202 (= R223)
Sites not aligning to the query:
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
33% identity, 52% coverage: 23:231/399 of query aligns to 10:206/339 of 5kiaA
- active site: C37 (= C47), G38 (= G48), T39 (≠ S49), H42 (= H52), H61 (= H68), E62 (= E69), C91 (= C98), C94 (= C101), C97 (= C104), C105 (= C112), V109 (= V127), P147 (≠ I171), A151 (≠ G175)
- binding calcium ion: D146 (= D170), N150 (≠ T174)
- binding zinc ion: C91 (= C98), C94 (= C101), C97 (= C104), C105 (= C112)
Sites not aligning to the query:
7xy9A Cryo-em structure of secondary alcohol dehydrogenases tbsadh after carrier-free immobilization based on weak intermolecular interactions
34% identity, 56% coverage: 38:260/399 of query aligns to 29:241/344 of 7xy9A
Sites not aligning to the query:
3fplA Chimera of alcohol dehydrogenase by exchange of the cofactor binding domain res 153-295 of c. Beijerinckii adh by t. Brockii adh (see paper)
34% identity, 56% coverage: 38:260/399 of query aligns to 28:240/351 of 3fplA
- active site: C37 (= C47), T38 (≠ G48), S39 (= S49), H42 (= H52), H59 (= H68), E60 (= E69), D89 (≠ C98), S92 (≠ C101), V95 (≠ C104), S103 (≠ T109), D150 (= D170), T154 (= T174)
- binding zinc ion: C37 (= C47), H59 (= H68), D150 (= D170)
Sites not aligning to the query:
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
33% identity, 50% coverage: 37:235/399 of query aligns to 30:214/346 of 2dfvA
- active site: C40 (= C47), G41 (= G48), T42 (≠ S49), H45 (= H52), H65 (= H68), E66 (= E69), C95 (= C98), C98 (= C101), C101 (= C104), C109 (= C112), K113 (≠ N116), P151 (≠ I171), A155 (≠ G175)
- binding nicotinamide-adenine-dinucleotide: G175 (= G196), P176 (= P197), L177 (≠ V198), E197 (≠ D218), P198 (≠ V219), R202 (= R223)
- binding zinc ion: C95 (= C98), C101 (= C104), C109 (= C112)
Sites not aligning to the query:
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
33% identity, 50% coverage: 37:235/399 of query aligns to 32:216/348 of O58389
- C42 (= C47) binding
- T44 (≠ S49) mutation to A: Total loss of enzymatic activity.
- H67 (= H68) binding
- E68 (= E69) binding
- C97 (= C98) binding
- C100 (= C101) binding
- C103 (= C104) binding
- C111 (= C112) binding
- E152 (≠ D170) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ V198) binding
- E199 (≠ D218) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R223) binding ; mutation to A: Large decrease in affinity for NAD(+).
Sites not aligning to the query:
- 266:268 binding
- 291:292 binding
- 294 R→A: 4000-fold decrease in catalytic efficiency.
7uutA Ternary complex crystal structure of secondary alcohol dehydrogenases from the thermoanaerobacter ethanolicus mutants c295a and i86a provides better understanding of catalytic mechanism (see paper)
34% identity, 56% coverage: 38:260/399 of query aligns to 28:240/352 of 7uutA
- binding (2R)-pentan-2-ol: S39 (= S49), H59 (= H68), A85 (≠ F94), W110 (≠ G122), D150 (= D170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C37 (= C47), T38 (≠ G48), S39 (= S49), D150 (= D170), T154 (= T174), G174 (= G194), G176 (= G196), P177 (= P197), V178 (= V198), S199 (≠ V219), R200 (≠ N220)
- binding zinc ion: C37 (= C47), H59 (= H68), D150 (= D170)
Sites not aligning to the query:
7ux4A Crystallographic snapshots of ternary complexes of thermophilic secondary alcohol dehydrogenase from thermoanaerobacter pseudoethanolicus reveal the dynamics of ligand exchange and the proton relay network. (see paper)
34% identity, 56% coverage: 38:260/399 of query aligns to 26:238/350 of 7ux4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D148 (= D170), T152 (= T174), G172 (= G194), I173 (≠ A195), G174 (= G196), P175 (= P197), V176 (= V198), R198 (≠ N220)
- binding (1S,3S)-3-methylcyclohexan-1-ol: S37 (= S49), H57 (= H68), W108 (≠ G122), D148 (= D170)
- binding zinc ion: C35 (= C47), H57 (= H68), E58 (= E69), D148 (= D170)
Sites not aligning to the query:
1ykfA NADP-dependent alcohol dehydrogenase from thermoanaerobium brockii (see paper)
34% identity, 56% coverage: 38:260/399 of query aligns to 28:240/352 of 1ykfA
- active site: C37 (= C47), T38 (≠ G48), S39 (= S49), H42 (= H52), H59 (= H68), E60 (= E69), D89 (≠ C98), T92 (≠ C101), V95 (≠ C104), S103 (≠ T109), D150 (= D170), T154 (= T174)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (= S49), D150 (= D170), T154 (= T174), G174 (= G194), I175 (≠ A195), G176 (= G196), P177 (= P197), V178 (= V198), S199 (≠ V219), R200 (≠ N220), Y218 (≠ S238), I223 (≠ L243)
- binding zinc ion: C37 (= C47), H59 (= H68), D150 (= D170)
Sites not aligning to the query:
1bxzB Crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii (see paper)
34% identity, 56% coverage: 38:260/399 of query aligns to 28:240/352 of 1bxzB
- active site: C37 (= C47), T38 (≠ G48), S39 (= S49), H42 (= H52), H59 (= H68), E60 (= E69), D89 (≠ C98), T92 (≠ C101), V95 (≠ C104), S103 (≠ T109), D150 (= D170), T154 (= T174)
- binding 2-butanol: H59 (= H68), D150 (= D170)
Sites not aligning to the query:
Query Sequence
>GFF5107 FitnessBrowser__WCS417:GFF5107
MSGNRGVVYLGSGKVEVQKIDYPKMQDPRGRKIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVIEKGSDVENLKIGDLVSVPFNVACGRCRSCKEQHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIIGDVNSIRLAHAKGQGFEVVDLSTD
TPLHEQIAALLGEPEVDCAVDCVGFEARGHGHDGVKAEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRINIA
EIVGVQVISLDDAPRGYGEFDAGVPKKFVIDPHKLFSAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory