SitesBLAST
Comparing GFF5186 FitnessBrowser__WCS417:GFF5186 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
25% identity, 59% coverage: 158:399/407 of query aligns to 114:385/830 of Q9AGP8
- V174 (= V219) binding
- H225 (≠ K265) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (≠ V292) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- VWVT 360:363 (≠ LGFT 374:377) binding
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
25% identity, 59% coverage: 158:399/407 of query aligns to 111:382/827 of 3gsiA
- active site: H222 (≠ K265), Y256 (≠ V292)
- binding flavin-adenine dinucleotide: T170 (≠ K218), V171 (= V219), A200 (= A248), G201 (= G249), W203 (≠ R251), H222 (≠ K265), Y256 (≠ V292), G330 (= G345), I331 (≠ M346), F332 (≠ R347), V357 (≠ L374), W358 (≠ G375), V359 (≠ F376), T360 (= T377)
- binding magnesium ion: D254 (≠ K290)
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49
- binding magnesium ion: 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
25% identity, 59% coverage: 158:399/407 of query aligns to 111:382/827 of 1pj7A
- active site: H222 (≠ K265), Y256 (≠ V292)
- binding flavin-adenine dinucleotide: T170 (≠ K218), V171 (= V219), A200 (= A248), G201 (= G249), W203 (≠ R251), H222 (≠ K265), Y256 (≠ V292), I331 (≠ M346), V357 (≠ L374), W358 (≠ G375), V359 (≠ F376), T360 (= T377)
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
25% identity, 59% coverage: 158:399/407 of query aligns to 112:383/828 of 1pj6A
- active site: H223 (≠ K265), Y257 (≠ V292)
- binding flavin-adenine dinucleotide: V172 (= V219), A201 (= A248), G202 (= G249), W204 (≠ R251), H223 (≠ K265), Y257 (≠ V292), G331 (= G345), I332 (≠ M346), V358 (≠ L374), W359 (≠ G375), V360 (≠ F376), T361 (= T377)
Sites not aligning to the query:
- active site: 550
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 96% coverage: 2:390/407 of query aligns to 4:344/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I5), G8 (= G6), G10 (= G8), V11 (= V9), I12 (= I10), V30 (≠ I28), E31 (≠ D29), K32 (≠ R31), E38 (= E37), A39 (≠ T38), S40 (= S39), A43 (≠ N42), G45 (= G44), L46 (≠ Q45), V171 (= V219), G200 (≠ A248), G201 (= G249), W203 (≠ R251), G298 (= G345), R300 (= R347), P301 (= P348), Y326 (≠ G372), R327 (≠ A373), N328 (≠ L374), G329 (= G375), I330 (≠ F376)
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
25% identity, 59% coverage: 161:399/407 of query aligns to 123:362/377 of Q5L2C2
- V180 (= V219) binding
- R309 (= R347) binding
- 334:340 (vs. 371:377, 29% identical) binding
- R336 (≠ A373) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 59% coverage: 161:399/407 of query aligns to 122:360/370 of 4yshA
- active site: I262 (≠ V302), L283 (≠ M323), G305 (= G345), N335 (≠ L374), L338 (≠ T377)
- binding flavin-adenine dinucleotide: V178 (= V219), S206 (≠ A248), G207 (= G249), W209 (≠ R251), R307 (= R347), H332 (= H371), R334 (≠ A373), N335 (≠ L374), G336 (= G375), I337 (≠ F376)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 59% coverage: 161:399/407 of query aligns to 122:360/368 of 4yshB
- active site: I262 (≠ V302), L283 (≠ M323), G305 (= G345), N335 (≠ L374), L338 (≠ T377)
- binding flavin-adenine dinucleotide: V178 (= V219), S206 (≠ A248), W209 (≠ R251), R307 (= R347), H332 (= H371), R334 (≠ A373), N335 (≠ L374), G336 (= G375), I337 (≠ F376), L338 (≠ T377)
- binding glycine: G249 (≠ I291), Y251 (= Y293), Y251 (= Y293), A264 (= A304), R307 (= R347), R334 (≠ A373), R334 (≠ A373)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
27% identity, 44% coverage: 216:395/407 of query aligns to 202:375/403 of 2gagB
- binding flavin-adenine dinucleotide: G224 (≠ A247), A225 (= A248), H227 (≠ Y250), L231 (vs. gap), L246 (= L264), G352 (= G372), T353 (≠ A373), G354 (≠ L374), G355 (= G375), F356 (= F376), K357 (≠ T377)
- binding flavin mononucleotide: V250 (vs. gap), E278 (= E298), R321 (≠ V341), W323 (= W343)
- binding 2-furoic acid: M263 (≠ I284), Y270 (≠ I291), K357 (≠ T377)
- binding sulfite ion: K276 (≠ I296)
Sites not aligning to the query:
- active site: 61, 64, 65
- binding flavin-adenine dinucleotide: 26, 28, 29, 30, 51, 52, 58, 59, 60, 62, 63, 64, 66, 195
- binding flavin mononucleotide: 61, 62, 171
- binding 2-furoic acid: 64, 66, 68, 401
- binding sulfite ion: 170
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
27% identity, 44% coverage: 216:395/407 of query aligns to 204:377/405 of Q50LF2
- H270 (≠ R289) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (≠ I291) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G372) binding
- G357 (= G375) binding
- K359 (≠ T377) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
- 172 K→A: Retains 39% of wild-type activity.; K→D: Retains 32% of wild-type activity.; K→R: Retains 58% of wild-type activity.
- 173 modified: Tele-8alpha-FMN histidine
- 197 binding
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
27% identity, 44% coverage: 216:395/407 of query aligns to 203:376/402 of 1vrqB
- active site: G326 (= G345), K358 (≠ T377)
- binding n,n-dimethylglycine: K358 (≠ T377)
- binding flavin-adenine dinucleotide: A224 (≠ L246), G225 (≠ A247), H228 (≠ Y250), L247 (= L264), G353 (= G372), T354 (≠ A373), G355 (≠ L374), G356 (= G375), F357 (= F376), K358 (≠ T377)
- binding flavin mononucleotide: V251 (vs. gap), E279 (= E298), R322 (≠ V341), W324 (= W343)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67, 196
- binding flavin mononucleotide: 62, 63, 172
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
27% identity, 44% coverage: 216:395/407 of query aligns to 203:376/404 of 3ad8B
- active site: G326 (= G345), K358 (≠ T377)
- binding flavin-adenine dinucleotide: G225 (≠ A247), A226 (= A248), H228 (≠ Y250), L247 (= L264), G353 (= G372), T354 (≠ A373), G355 (≠ L374), G356 (= G375), F357 (= F376), K358 (≠ T377)
- binding flavin mononucleotide: V251 (vs. gap), E279 (= E298), R322 (≠ V341), W324 (= W343)
- binding pyrrole-2-carboxylate: M264 (≠ I284), Y271 (≠ I291), T354 (≠ A373), K358 (≠ T377)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67, 196
- binding flavin mononucleotide: 62, 63, 172
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
27% identity, 44% coverage: 216:395/407 of query aligns to 203:376/404 of 3ad7B
- active site: G326 (= G345), K358 (≠ T377)
- binding flavin-adenine dinucleotide: G225 (≠ A247), A226 (= A248), H228 (≠ Y250), L247 (= L264), G353 (= G372), T354 (≠ A373), G355 (≠ L374), G356 (= G375), F357 (= F376), K358 (≠ T377)
- binding flavin mononucleotide: V251 (vs. gap), K277 (≠ I296), E279 (= E298), R322 (≠ V341), W324 (= W343)
- binding [methylthio]acetate: M264 (≠ I284), Y271 (≠ I291), T354 (≠ A373), K358 (≠ T377)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67, 196
- binding flavin mononucleotide: 62, 63, 172
- binding [methylthio]acetate: 67, 69, 402
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
23% identity, 66% coverage: 123:390/407 of query aligns to 79:346/369 of S5FMM4
- K81 (≠ D125) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ A248) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ F376) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L386) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
6j39A Crystal structure of cmis2 with inhibitor (see paper)
27% identity, 24% coverage: 295:390/407 of query aligns to 256:351/368 of 6j39A
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49, 243, 252
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44, 174, 203, 206, 228, 252
6j38A Crystal structure of cmis2 (see paper)
27% identity, 24% coverage: 295:390/407 of query aligns to 256:351/368 of 6j38A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44, 174, 203, 206, 226
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
27% identity, 43% coverage: 216:392/407 of query aligns to 204:374/405 of P40875
- C351 (≠ L369) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
- 146 C→S: No change in activity.
- 173 modified: Tele-8alpha-FMN histidine; H→N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- 175 H→A: No effect on FMN binding and activity.
- 195 C→S: No change in activity.
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
51% identity, 11% coverage: 2:44/407 of query aligns to 6:48/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G6), G12 (= G8), I14 (= I10), E33 (≠ D29), K34 (≠ A30), E41 (= E37), T42 (= T38), S43 (= S39), A45 (= A41), N46 (= N42), S47 (≠ G43)
- binding sn-glycerol-3-phosphate: S47 (≠ G43)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 49, 51, 176, 177, 209, 210, 212, 234, 319, 320, 346, 347, 348, 349, 350, 351, 352
- binding sn-glycerol-3-phosphate: 51, 258, 259, 320, 348
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
51% identity, 11% coverage: 2:44/407 of query aligns to 6:48/384 of P75063
Sites not aligning to the query:
- 47:49 binding
- 177 binding
- 346:347 binding
- 352 binding
Query Sequence
>GFF5186 FitnessBrowser__WCS417:GFF5186
MVCIIGGGVIGLASAYALVRAGHEVTLIDARETLGSETSFANGGQLSYRYVAPLADAGVP
LQAIGWLLRGDSPLKLRPRLDPQQWRWMAAFLGACRGSVNKRNAAHLLRLASLSQDTLQV
WRDLDRLDGFDWRRNGKLVTFRNANAFERARGKVTDILQQQVLSTADCARLEPALADGGF
VGGIYTPNEEVADCHAFCQRLAARLEASGRCRFMLGRKVTGIRHAKGRVQAIELGDEVMP
VEHLVLAAGYRSAELGVPLPLYPLKGYSLSVPIGAQHQAPNVSITDYDRKIVYARIGEQL
RVAAMVDIVGFDARLEPKRLALMKRQALEIFPLAGDYDQAVEWAGMRPATPTGVPLIGAS
VYRNLWLNLGHGALGFTLACGSGQLLAELIGQHAPSIDMQGLAPRAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory