Comparing GFF52 FitnessBrowser__WCS417:GFF52 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
8jejA Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
24% identity, 96% coverage: 9:580/594 of query aligns to 7:535/540 of 8jejA
7w2jD Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
24% identity, 96% coverage: 9:580/594 of query aligns to 4:532/537 of 7w2jD
7qf8A Crystal structure of a bacterial pyranose 2-oxidase from pseudoarthrobacter siccitolerans (see paper)
29% identity, 24% coverage: 444:583/594 of query aligns to 353:486/494 of 7qf8A
Sites not aligning to the query:
7qfdA Crystal structure of a bacterial pyranose 2-oxidase complex with d- glucose (see paper)
29% identity, 24% coverage: 444:583/594 of query aligns to 319:452/458 of 7qfdA
Sites not aligning to the query:
7qvaA Crystal structure of a bacterial pyranose 2-oxidase in complex with mangiferin (see paper)
29% identity, 24% coverage: 444:583/594 of query aligns to 318:451/457 of 7qvaA
Sites not aligning to the query:
>GFF52 FitnessBrowser__WCS417:GFF52
MATIMKKVDAVIVGFGWTGAIMAKELTEAGLNVVALERGPMQDTYPDGNYPQVIDELTYS
VRKKLFQDISKETVTIRHSVNDVALPNRQLGAFLPGNGVGGAGLHWSGVHFRVDPIELRM
RSHYEERYGKHFIPKDMTIQDFGVSYEELEPFFDYAEKVFGTSGQAWTVKGQLVGEGRGG
NPYAPDRSNPFPLESQKNTVSAQLFQKAAAEVGYKPYNLPSANTSGPYTNPYGAQMGPCN
FCGFCSGYVCYMYSKASPNVNILPALRQVPNFELRPNSHVLKVNLDSTKSKATGVTYIDA
QGRECEQPAELVILGAFQFHNVRLMLLSGIGKPYDPITNEGVVGRNFAYQNMATIKAFFD
KDTHTNNFIGAGGNGVAIDDFNADNFDHGPHGFVGGSPMWVNQAGSRPIAGTSNPPGTPA
WGSAWKRATADYYTHQVSMDAHGAHQSYRGNYLDLDPVYRDAYGQPLLRMTFDWQENDIK
MNRFMVEKMGKVAEAMNPKAIAVLGKKVGEHFNTASYQTTHLNGGAIMGTDPKTSALNRY
LQCWDVHNVFVPGASAFPQGLGYNPTGLVAALTYWSARAIREQYLKNPGPLVQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory