Comparing GFF524 FitnessBrowser__WCS417:GFF524 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
34% identity, 96% coverage: 6:284/291 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 96% coverage: 6:284/291 of query aligns to 4:253/254 of 1g6hA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
27% identity, 98% coverage: 1:284/291 of query aligns to 1:238/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 96% coverage: 6:284/291 of query aligns to 2:235/240 of 6mjpA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
26% identity, 91% coverage: 9:272/291 of query aligns to 4:223/240 of 4ymuJ
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
29% identity, 92% coverage: 6:273/291 of query aligns to 2:227/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
29% identity, 93% coverage: 4:273/291 of query aligns to 2:229/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
29% identity, 93% coverage: 4:273/291 of query aligns to 2:229/263 of 7d08B
3c4jA Abc protein artp in complex with atp-gamma-s
25% identity, 93% coverage: 6:277/291 of query aligns to 3:230/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
25% identity, 93% coverage: 6:277/291 of query aligns to 3:230/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
25% identity, 93% coverage: 6:277/291 of query aligns to 3:230/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
25% identity, 93% coverage: 6:277/291 of query aligns to 3:230/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 93% coverage: 6:277/291 of query aligns to 2:228/241 of 4u00A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
27% identity, 97% coverage: 6:286/291 of query aligns to 2:237/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
27% identity, 97% coverage: 6:286/291 of query aligns to 2:237/238 of 6s8gA
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
30% identity, 90% coverage: 4:266/291 of query aligns to 2:222/501 of P04983
6mbnA Lptb e163q in complex with atp (see paper)
27% identity, 97% coverage: 6:286/291 of query aligns to 3:238/241 of 6mbnA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
27% identity, 96% coverage: 6:284/291 of query aligns to 2:235/235 of 6mhzA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
27% identity, 93% coverage: 4:273/291 of query aligns to 2:224/285 of 4yerA
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
25% identity, 98% coverage: 3:287/291 of query aligns to 3:233/353 of 1vciA
>GFF524 FitnessBrowser__WCS417:GFF524
MSKEVVLSVEHLMMHFGGIKALSDVSLKVERNSIFALIGPNGAGKTTVFNCLTGFYKASG
GKIELNIRGKRTNVIQLLGERFQPTDFVSPKRFFSRVFYKMFGGTHWVNRAGLARTFQNI
RLFKEMSVVENLLVAQHMWVNRNMLAGILNTKGYRKAESDALDHAFYWLEVVDLVDCANR
LAGELSYGQQRRLEIARAMCTRPQIICLDEPAAGLNPQETEALSAMIRLLRDEHDLTVVL
IEHDMGMVMSISDHIVVLDHGNVIAEGGPDAIRNDPKVIAAYLGADEEELV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory