Comparing GFF5272 FitnessBrowser__WCS417:GFF5272 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
O53289 Phosphoserine phosphatase SerB2; PSP; PSPase; O-phosphoserine phosphohydrolase; Protein-serine/threonine phosphatase; EC 3.1.3.3; EC 3.1.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
24% identity, 94% coverage: 2:207/218 of query aligns to 180:369/409 of O53289
Sites not aligning to the query:
A0QJI1 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Mycobacterium avium (strain 104) (see paper)
24% identity, 94% coverage: 2:207/218 of query aligns to 182:371/411 of A0QJI1
5jlpA Crystal structure of mycobacterium avium serb2 in complex with serine at act domain
24% identity, 94% coverage: 2:207/218 of query aligns to 178:367/396 of 5jlpA
Sites not aligning to the query:
8a21A Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with phenylimidazole (see paper)
24% identity, 94% coverage: 2:207/218 of query aligns to 178:367/396 of 8a21A
Sites not aligning to the query:
8a1zA Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with 1-(2,4-dichlorophenyl)-3-hydroxyurea (see paper)
24% identity, 94% coverage: 2:207/218 of query aligns to 178:367/396 of 8a1zA
>GFF5272 FitnessBrowser__WCS417:GFF5272
MRLALFDLDNTLLGGDSDHAWGDYLCERGILDPVAYKARNDEFYQDYLAGKLDNAAYLNF
CLEILGRTEMAQLEEWHNDYMRDCIEPILLPLATELLAKHRAAGDKLVIITATNRFVTAP
IAARLGVETLIATECEMENGRYTGRSTDVPCFREGKVTRLNRWLEETGYNLEDSYFYSDS
MNDLPLLEQVTHPVAVDPDPNLRAEAEKRGWPVITLRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory