SitesBLAST
Comparing GFF53 FitnessBrowser__WCS417:GFF53 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
55% identity, 96% coverage: 12:413/420 of query aligns to 31:434/478 of Q47945
- Q37 (≠ S18) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
56% identity, 94% coverage: 20:413/420 of query aligns to 1:396/433 of 8gy2B
- binding heme c: C18 (= C37), C21 (= C40), H22 (= H41), T46 (= T65), I48 (= I67), Y59 (= Y77), L68 (≠ V86), R73 (≠ A91), V79 (≠ L97), Y80 (= Y98), M83 (= M101), F88 (≠ Y106), R126 (= R144), H165 (= H183), C166 (= C184), C169 (= C187), H170 (= H188), I201 (= I219), A202 (= A220), P203 (≠ K221), L205 (= L223), W216 (= W234), F224 (= F242), A234 (= A252), V235 (= V253), F236 (= F254), F236 (= F254), M239 (= M257), N301 (= N319), C302 (= C320), C305 (= C323), H306 (= H324), M316 (≠ V334), F317 (= F335), P318 (= P336), L320 (= L338), P324 (= P342), G342 (= G360), S352 (= S370), V354 (≠ F372), M356 (= M374), F359 (= F377), M375 (≠ V393)
- binding ubiquinone-10: C21 (= C40), L34 (= L53), P39 (= P58), P81 (= P99), L129 (= L147), W132 (= W150), E168 (≠ A186), R173 (= R191), I197 (≠ L215), D241 (= D259)
Sites not aligning to the query:
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
37% identity, 93% coverage: 25:413/420 of query aligns to 1:400/413 of 8jejC
- binding heme c: C13 (= C37), C16 (= C40), H17 (= H41), T42 (= T65), I44 (= I67), F60 (= F82), L64 (≠ V86), L75 (= L97), Y76 (= Y98), M79 (= M101), P80 (= P102), Y84 (= Y106), R122 (= R144), C162 (= C184), C165 (= C187), H166 (= H188), I186 (≠ L215), W189 (= W218), A191 (= A220), P192 (≠ K221), I194 (≠ L223), W205 (= W234), Y213 (≠ F242), R223 (≠ A252), M228 (= M257), V303 (≠ N319), C304 (= C320), C307 (= C323), H308 (= H324), Y320 (≠ F335), P321 (= P336), L323 (= L338), T327 (≠ P342), T328 (≠ V343), D336 (≠ S351), I341 (≠ V356), V345 (≠ G360), R347 (≠ L362), I354 (≠ F372), M356 (= M374), F359 (= F377), I376 (≠ V389)
- binding ubiquinone-10: M36 (≠ I59), P77 (= P99), S124 (≠ P146), W128 (= W150), C165 (= C187), L173 (≠ S201)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 93% coverage: 25:413/420 of query aligns to 1:386/418 of 7w2jC
- binding heme c: C13 (= C37), C16 (= C40), H17 (= H41), T42 (= T65), I44 (= I67), Y55 (= Y77), L75 (= L97), Y76 (= Y98), A78 (= A100), M79 (= M101), R122 (= R144), H161 (= H183), C162 (= C184), C165 (= C187), H166 (= H188), A191 (= A220), P192 (≠ K221), R223 (≠ A252), P227 (≠ G256), M228 (= M257), V289 (≠ N319), C290 (= C320), C293 (= C323), H294 (= H324), Y305 (≠ V334), Y306 (≠ F335), P307 (= P336), L309 (= L338), N312 (= N341), T313 (≠ P342), T314 (≠ V343), D322 (≠ S351), I327 (≠ V356), V331 (≠ G360), R333 (≠ T365), I340 (≠ F372), M342 (= M374), P343 (= P375), F345 (= F377)
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
34% identity, 90% coverage: 16:394/420 of query aligns to 32:408/440 of 8gy3A
- binding heme c: Y52 (≠ D36), C53 (= C37), C56 (= C40), H57 (= H41), S84 (≠ T65), I86 (= I67), W97 (≠ Y77), F102 (= F82), L117 (= L97), F121 (≠ M101), F126 (≠ Y106), R163 (= R144), C203 (= C184), C206 (= C187), H207 (= H188), A232 (= A220), P233 (≠ K221), L235 (= L223), W245 (= W234), Y253 (≠ F242), L254 (= L243), G263 (≠ S251), S264 (≠ A252), M269 (= M257), Y292 (≠ L280), C337 (= C320), C340 (= C323), H341 (= H324), P353 (= P336), L355 (= L338), N358 (= N341), N359 (≠ P342), V372 (≠ I355), I377 (≠ G360), G382 (≠ A368), Q383 (≠ P369), I386 (≠ F372), M388 (= M374), F391 (= F377)
- binding ubiquinone-10: E55 (≠ A39), T76 (= T57), F78 (≠ I59), Y118 (= Y98), P119 (= P99), I160 (≠ L141), G166 (≠ P146), Q167 (≠ L147), F169 (≠ A149), W170 (= W150), H202 (= H183), R210 (= R191), L213 (≠ T194)
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
33% identity, 33% coverage: 274:413/420 of query aligns to 305:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C320), C350 (= C323), H351 (= H324), F362 (= F335), P363 (= P336), P364 (≠ A337), L365 (= L338), S368 (≠ N341), Y370 (≠ V343), I382 (≠ V356), L386 (≠ G360), S387 (≠ T361), G388 (≠ L362), I390 (vs. gap), V392 (≠ T365), Y397 (≠ S370), N398 (≠ T371), G399 (≠ F372), V400 (≠ T373), M401 (= M374)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
34% identity, 28% coverage: 299:415/420 of query aligns to 339:454/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ N319), C360 (= C320), C363 (= C323), H364 (= H324), P376 (= P336), P377 (≠ A337), L378 (= L338), F383 (≠ V343), N400 (vs. gap), G401 (= G360), Y410 (≠ P369), S412 (≠ T371), M414 (= M374), M417 (≠ F377)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
34% identity, 28% coverage: 299:415/420 of query aligns to 340:455/456 of 5oboA
- binding heme c: T360 (≠ N319), C361 (= C320), C364 (= C323), H365 (= H324), P377 (= P336), P378 (≠ A337), L379 (= L338), S382 (≠ N341), F384 (≠ V343), I395 (= I355), N401 (vs. gap), G402 (= G360), S413 (≠ T371), M415 (= M374), M418 (≠ F377)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
34% identity, 28% coverage: 299:415/420 of query aligns to 342:457/457 of 4ax3D
- binding heme c: C363 (= C320), C366 (= C323), H367 (= H324), P379 (= P336), P380 (≠ A337), L381 (= L338), S384 (≠ N341), F386 (≠ V343), N403 (vs. gap), G404 (= G360), S415 (≠ T371), M417 (= M374), M420 (≠ F377)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
28% identity, 24% coverage: 313:413/420 of query aligns to 23:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C320), C33 (= C323), H34 (= H324), Y46 (≠ F335), P47 (= P336), T54 (≠ V343), V66 (≠ I355), I67 (≠ V356), R73 (≠ T365), I80 (≠ F372), M82 (= M374), P83 (= P375)
Query Sequence
>GFF53 FitnessBrowser__WCS417:GFF53
MKALVIATFALFSSCSVSAAETDLIKQGEYLARAGDCVACHTAKGGKPFAGGLPMETPIG
VIYSTNITPDKTGLGDYSFEDFDKAVRHGVAKSGSTLYPAMPYPSYARVSDSDMQALYAY
FMKGVEPVAQENKDSDIPWPLSMRWPLAAWRWMFAPAVEEHQAQAVVDPVISRGAYLVEG
LGHCGACHTPRALTMQEKALSATDGNAFLAGSAPLEGWIAKSLRGDHKDGLGSWSEEQLV
QFLKTGRSDRSAVFGGMSDVVVHSMQYMSENDLTAIARYLKSLPAVDPKDSPHTYDKQVA
EALWKGDDSQRGASVYIDNCAACHRTDGHGYTRVFPALAGNPVLQTADATSLINIVLNGG
TLPATHTAPSTFTMPAFAWRLSDQEVADVVSFVRGSWGNTGGAISAAQVADIRKKSGDKN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory