Comparing GFF530 FitnessBrowser__Phaeo:GFF530 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
1sz2B Crystal structure of e. Coli glucokinase in complex with glucose (see paper)
26% identity, 94% coverage: 8:304/316 of query aligns to 5:308/320 of 1sz2B
8dtcA Crystal structure of glucokinase with bound glucose from acanthamoeba castellanii
26% identity, 80% coverage: 5:256/316 of query aligns to 23:318/374 of 8dtcA
>GFF530 FitnessBrowser__Phaeo:GFF530
MGSDMTVLVGDVGGSNTRLALAGPEIGVTALQSFANDSFSSLDDVLAAYCAQPDLPPLAG
ACIAVAGPVYGNEYQLTNRNWQGSAADLAQQLQLGAGARVDVINDLAALGHSLLALIPGQ
LSSLRAGHQRGTQALVAGIGTGFNVSLSVDGHTAEAEMGHTSLSAPVTRGLTDLLGDRAG
EFATNEDLFSGRGLVRYHQALHGIAAEGGAQIVADYLADGDSPAAKTVTSWARLLGDFAR
ELVPTYMPGQGIFFAGSVARGILGTAACEVFLNSFLQPATGVQSRCETTPLWLITDDAAG
VSGAARFALERAGRKS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory