SitesBLAST
Comparing GFF5341 FitnessBrowser__WCS417:GFF5341 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P0AGC0 Hexose-6-phosphate:phosphate antiporter from Escherichia coli (strain K12) (see paper)
33% identity, 94% coverage: 10:428/445 of query aligns to 6:442/463 of P0AGC0
- C108 (≠ V106) mutation to S: No change in activity.
- C143 (≠ P140) mutation to S: 30% of wild-type sugar phosphate transport activity.
- C265 (≠ A259) mutation to S: No change in activity.
- C331 (≠ I326) mutation to S: No change in activity.
- C436 (≠ A423) mutation to S: No change in activity.
- C438 (= C424) mutation to S: No change in activity.
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
25% identity, 90% coverage: 25:426/445 of query aligns to 12:414/430 of P0AA76
- Y29 (= Y42) binding
- D31 (≠ L44) mutation to N: Loss of galactonate transport activity.
- R32 (= R45) binding
- Y64 (= Y76) binding
- E118 (≠ Q134) mutation to Q: Loss of galactonate transport activity.
- W358 (≠ G369) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
25% identity, 90% coverage: 25:426/445 of query aligns to 1:395/409 of 6e9nA
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
23% identity, 81% coverage: 84:442/445 of query aligns to 78:439/452 of Q5EXK5
- D82 (= D88) mutation to A: Loss of activity.
- V311 (≠ W311) mutation to W: Loss of activity.
- D314 (= D314) mutation to A: Loss of activity.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
22% identity, 59% coverage: 53:315/445 of query aligns to 53:324/448 of Q51955
- G85 (= G84) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D88) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (≠ N91) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (≠ L127) mutation to A: Abolishes 4-HBA transport.
- E144 (≠ H147) mutation to A: Strong decrease in 4-HBA transport.
- H183 (= H187) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D314) mutation to N: Abolishes 4-HBA transport and chemotaxis.
Sites not aligning to the query:
- 41 mutation D->A,N: Abolishes 4-HBA transport.; D→E: Decrease in 4-HBA transport.
- 44 mutation D->A,N: Abolishes 4-HBA transport.; D→E: Decrease in 4-HBA transport.
- 328 H→A: Decrease in 4-HBA transport and chemotaxis.; H→R: Decrease in 4-HBA transport and loss of chemotaxis.
- 386 R→A: Strong decrease in 4-HBA transport.
- 398 R→A: Abolishes 4-HBA transport.
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
22% identity, 63% coverage: 12:291/445 of query aligns to 26:327/495 of Q9NRA2
- R39 (= R25) to C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
- K136 (≠ R93) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ G142) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ VV 157:158) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ YD 231:232) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ ASHED 233:237) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 328 G → E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- 334 P → R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- 371 G → V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Query Sequence
>GFF5341 FitnessBrowser__WCS417:GFF5341
MFAFFRPAAHQAPLPEEKIDSTYRRLRWQIFAGIFFGYAGYYLLRKNFSLAMPYLIDEGY
TRGELGLAMSAIAIAYGLSKFLMGLVSDRSNPRYFLPFGLLVSAGVMFIFGFAPWATSSV
TMMFILLFINGWAQGMGWPPSGRTMVHWWSQKERGGVVSVWNVAHNVGGGLIGPLFLLGM
AWFNDWHAAFYVPATVALLVAAFAFITMRDTPQSVGLPPIEKYKNDYPEGYDASHEDEFS
AKEIFVKYVLRNKMLWYIAFANVFVYLLRYGVLDWAPTYLKEAKHFTVDKSSWAYFFYEW
AGIPGTLLCGWMSDKIFRGNRGLTGIVFMALVTVATLVYWLNPPGNPMVDMIALFSIGFL
IYGPVMLIGLQALELAPKKAAGTAAGFTGLFGYLGGSVAASAAMGYTVDHFGWDGGFVLL
IGACLLAIAFLIPTLWHTNSVSSAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory