SitesBLAST
Comparing GFF5388 FitnessBrowser__WCS417:GFF5388 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
2gkjA Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor dl-azidap (see paper)
57% identity, 99% coverage: 3:276/276 of query aligns to 1:274/274 of 2gkjA
- active site: C73 (= C75), H159 (= H161), E208 (= E210), C217 (= C219), G220 (= G222)
- binding (2r,6s)-2,6-diamino-2-methylheptanedioic acid: N11 (= N13), Q44 (= Q46), N64 (= N66), C73 (= C75), G74 (= G76), N75 (= N77), N157 (= N159), N190 (= N192), E208 (= E210), R209 (= R211), C217 (= C219), G218 (= G220), S219 (≠ T221)
2gkeA Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor ll-azidap (see paper)
57% identity, 99% coverage: 3:276/276 of query aligns to 1:274/274 of 2gkeA
- active site: C73 (= C75), H159 (= H161), E208 (= E210), C217 (= C219), G220 (= G222)
- binding (2s,6s)-2,6-diamino-2-methylheptanedioic acid: N11 (= N13), F13 (= F15), Q44 (= Q46), N64 (= N66), V70 (= V72), C73 (= C75), G74 (= G76), N75 (= N77), N157 (= N159), N190 (= N192), E208 (= E210), R209 (= R211), C217 (= C219), G218 (= G220), S219 (≠ T221)
P44859 Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
57% identity, 99% coverage: 3:276/276 of query aligns to 1:274/274 of P44859
- N11 (= N13) binding
- Q44 (= Q46) binding
- N64 (= N66) binding
- C73 (= C75) mutation to A: Inactive as epimerase, but it is able to rapidly catalyze the HF elimination via abstraction of the C-2 hydrogen of the D,L-3-fluoro-DAP analog and is essentially unable to catalyze the same elimination with the L,L-3-fluoro-DAP analog.; mutation to S: Enzymatically active, but it adopts a more open conformation. It is able to catalyze both epimerization of DAP and HF elimination of L,L-3-fluoro-DAP and D,L-3-fluoro-DAP. Able to slowly eliminate HF but does not catalyze epimerization; when associated with S-217.
- GN 74:75 (= GN 76:77) binding
- N157 (= N159) binding
- N190 (= N192) binding
- ER 208:209 (= ER 210:211) binding
- C217 (= C219) mutation to A: Inactive as epimerase. It is able to rapidly catalyze the HF elimination via abstraction of the C-2 hydrogen of the L,L-3-fluoro-DAP analog and is essentially unable to catalyze the same elimination with the D,L-3-fluoro-DAP analog.; mutation to S: Enzymatically active, but it adopts a more open conformation. It is able to catalyze both epimerization of DAP and HF elimination of L,L-3-fluoro-DAP and D,L-3-fluoro-DAP. Able to slowly eliminate HF but does not catalyze epimerization; when associated with S-73.
- GS 218:219 (≠ GT 220:221) binding
P0A6K1 Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 from Escherichia coli (strain K12) (see paper)
55% identity, 99% coverage: 3:276/276 of query aligns to 1:274/274 of P0A6K1
- Y268 (= Y270) Important for dimerization; mutation to A: Significantly less active than the wild-type dimer and unable to dimerize.
3ejxD Crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap (see paper)
44% identity, 100% coverage: 2:276/276 of query aligns to 16:301/301 of 3ejxD
- active site: C89 (= C75), H180 (= H161), E235 (= E210), C244 (= C219), G247 (= G222)
- binding (2s,6s)-2,6-diamino-2-methylheptanedioic acid: N27 (= N13), F29 (= F15), N80 (= N66), P86 (≠ V72), C89 (= C75), G90 (= G76), N91 (= N77), N178 (= N159), N217 (= N192), E235 (= E210), R236 (= R211), C244 (= C219), G245 (= G220), T246 (= T221)
3ekmA Crystal structure of diaminopimelate epimerase form arabidopsis thaliana in complex with irreversible inhibitor dl-azidap (see paper)
44% identity, 100% coverage: 2:276/276 of query aligns to 2:287/287 of 3ekmA
- active site: C75 (= C75), H166 (= H161), E221 (= E210), C230 (= C219), G233 (= G222)
- binding (2r,6s)-2,6-diamino-2-methylheptanedioic acid: N13 (= N13), N66 (= N66), P72 (≠ V72), C75 (= C75), G76 (= G76), N77 (= N77), N164 (= N159), N203 (= N192), E221 (= E210), R222 (= R211), C230 (= C219), G231 (= G220), T232 (= T221)
Q8NP73 Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025)
28% identity, 100% coverage: 1:276/276 of query aligns to 3:277/277 of Q8NP73
5m47A Crystal structure of dapf from corynebacterium glutamicum in complex with d,l-diaminopimelate (see paper)
28% identity, 100% coverage: 1:276/276 of query aligns to 3:277/280 of 5m47A
- active site: C83 (= C75), H161 (= H161), E212 (= E210), C221 (= C219), G224 (= G222)
- binding 2,6-diaminopimelic acid: N15 (= N13), N74 (= N66), C83 (= C75), G84 (= G76), N85 (= N77), N159 (= N159), N194 (= N192), E212 (= E210), R213 (= R211), C221 (= C219), G222 (= G220), T223 (= T221)
P9WP19 Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 89% coverage: 5:251/276 of query aligns to 3:259/289 of P9WP19
- C87 (= C75) active site, Proton donor; mutation to A: Completely abolishes the diaminopimelate epimerase activity.; mutation to S: Strongly reduces the diaminopimelate epimerase activity.
- C226 (= C219) active site, Proton acceptor; mutation to A: Completely abolishes the diaminopimelate epimerase activity.; mutation to S: Strongly reduces the diaminopimelate epimerase activity.
Query Sequence
>GFF5388 FitnessBrowser__WCS417:GFF5388
MLLRFTKMHGLGNDFMVLDLVSQHAHILPKHAKQWGDRHTGIGFDQLLIVEAPSNPEVDF
RYRIFNADGSEVEQCGNGARCFARFVLDKRLTAKRQIRVETKSGVIELDIRSDGQISVNM
GAPRLVPADIPFQAPEQAASYALDVDGKTVEIAAVSMGNPHAVLRVNDINNAPVHELGPK
IEHHPRFPARVNVGFLQVIDRTRAQLRVWERGAGETQACGTGACAAAVAAISQGWMDSPL
LIDLPGGRLSIEWAGPGHPVMMTGPASRVYEGQVRL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory