Comparing GFF5391 FitnessBrowser__WCS417:GFF5391 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3vayA Crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. Tomato dc3000 (see paper)
61% identity, 99% coverage: 3:230/231 of query aligns to 2:229/230 of 3vayA
4ygrA Crystal structure of had phosphatase from thermococcus onnurineus (see paper)
32% identity, 60% coverage: 92:229/231 of query aligns to 71:212/215 of 4ygrA
Sites not aligning to the query:
6z1kA A de novo enzyme for the morita-baylis-hillman reaction bh32.6 (see paper)
23% identity, 93% coverage: 13:227/231 of query aligns to 5:226/231 of 6z1kA
6q7nA Crystal structure of bh32 alkylated with the mechanistic inhibitor 2- bromoacetophenone (see paper)
22% identity, 93% coverage: 13:227/231 of query aligns to 5:226/230 of 6q7nA
4ffdA Crystal structure of engineered protein. Northeast structural genomics consortium target or48
22% identity, 93% coverage: 13:227/231 of query aligns to 5:226/230 of 4ffdA
1zrmA Crystal structure of the reaction intermediate of l-2-haloacid dehalogenase with 2-chloro-n-butyrate (see paper)
34% identity, 54% coverage: 104:227/231 of query aligns to 91:220/220 of 1zrmA
Sites not aligning to the query:
Q53464 (S)-2-haloacid dehalogenase; 2-haloalkanoic acid dehalogenase; Halocarboxylic acid halidohydrolase; L-2-haloacid dehalogenase; L-DEX; EC 3.8.1.2 from Pseudomonas sp. (strain YL) (see 2 papers)
34% identity, 54% coverage: 104:227/231 of query aligns to 93:222/232 of Q53464
Sites not aligning to the query:
3i76B The crystal structure of the orthorhombic form of the putative had- hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement
26% identity, 97% coverage: 4:227/231 of query aligns to 4:226/229 of 3i76B
Q51645 (S)-2-haloacid dehalogenase 4A; 2-haloalkanoic acid dehalogenase IVA; Halocarboxylic acid halidohydrolase IVA; L-2-haloacid dehalogenase IVA; EC 3.8.1.2 from Burkholderia cepacia (Pseudomonas cepacia) (see 2 papers)
28% identity, 68% coverage: 71:228/231 of query aligns to 52:224/231 of Q51645
Sites not aligning to the query:
2no5B Crystal structure analysis of a dehalogenase with intermediate complex (see paper)
28% identity, 68% coverage: 71:228/231 of query aligns to 52:224/226 of 2no5B
Sites not aligning to the query:
3qnmA Haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function
25% identity, 98% coverage: 1:227/231 of query aligns to 1:230/231 of 3qnmA
4knvA The crystal structure of apo human hdhd4 from se-mad (see paper)
30% identity, 60% coverage: 89:227/231 of query aligns to 86:232/241 of 4knvA
Sites not aligning to the query:
2x4dA Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase lhpp
31% identity, 71% coverage: 64:227/231 of query aligns to 98:265/270 of 2x4dA
Sites not aligning to the query:
2x4dB Crystal structure of human phospholysine phosphohistidine inorganic pyrophosphate phosphatase lhpp
39% identity, 35% coverage: 143:222/231 of query aligns to 131:212/213 of 2x4dB
Sites not aligning to the query:
8wbtA Crystal structure of cis-epoxysuccinate hydrolases klcesh[l] mutant d48n complexed with l-ta (see paper)
29% identity, 54% coverage: 104:228/231 of query aligns to 101:234/237 of 8wbtA
Sites not aligning to the query:
3umbA Crystal structure of the l-2-haloacid dehalogenase rsc1362
30% identity, 45% coverage: 105:209/231 of query aligns to 97:206/227 of 3umbA
Sites not aligning to the query:
>GFF5391 FitnessBrowser__WCS417:GFF5391
MSIKLITFDLDDTLWDNVPVIISAEASMREWLTVNAAKVGDLPLEHFASLRQQVLERHPE
LKHRISLLRHRVLMHAFEEAGYPQPEATEMADVCFEAFIHARHQLAPFPEAEPMLKALRQ
HFLLGVITNGNADVQRVGLADYFHFALRAEDIGIAKPDARLFQEALQRGGVDASAAVHIG
DHPGDDIAGAQQAGLRAVWFNPTGKVWEADKRPDAEVRSLAELAPLLAGWK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory