SitesBLAST
Comparing GFF5415 FitnessBrowser__WCS417:GFF5415 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
24% identity, 84% coverage: 31:391/430 of query aligns to 25:370/383 of 5i39A
- active site: F66 (≠ N72), Q69 (= Q75), A70 (≠ L76), Q248 (vs. gap), P267 (= P276)
- binding flavin-adenine dinucleotide: V30 (= V36), G31 (= G37), G33 (= G39), I34 (≠ F40), L35 (≠ S41), V53 (≠ L59), E54 (= E60), K55 (≠ A61), Q62 (≠ A68), S63 (= S69), F66 (≠ N72), Y67 (≠ G73), Q69 (= Q75), A196 (≠ E210), A197 (≠ V211), G226 (vs. gap), G227 (vs. gap), W229 (vs. gap), Q248 (vs. gap), Q250 (≠ S258), G321 (= G341), M323 (≠ I343), T348 (≠ A369), G349 (= G370), W350 (≠ H371), G351 (= G372), M352 (≠ L373), T353 (≠ N374)
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
22% identity, 80% coverage: 46:388/430 of query aligns to 20:352/374 of 1y56B
- active site: F44 (≠ G70), G47 (= G73), T48 (≠ R78), H224 (≠ E268), P239 (≠ Q284), G305 (= G341), M338 (≠ N374)
- binding flavin-adenine dinucleotide: I33 (≠ L59), E34 (= E60), K35 (≠ A61), S42 (≠ A68), T43 (≠ S69), R45 (= R71), C46 (≠ N72), G47 (= G73), G49 (= G79), E170 (= E210), V171 (= V211), T200 (≠ C238), N201 (= N239), W203 (≠ Y241), G305 (= G341), Y306 (≠ M342), Y307 (≠ I343), G334 (= G370), H335 (= H371), G336 (= G372), F337 (≠ L373), M338 (≠ N374)
- binding flavin mononucleotide: F44 (≠ G70), R45 (= R71), I260 (≠ D296), R301 (≠ Y337), W303 (= W339)
Sites not aligning to the query:
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
21% identity, 85% coverage: 32:395/430 of query aligns to 3:352/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ V36), G8 (= G37), G10 (= G39), V11 (≠ F40), I12 (≠ S41), V30 (≠ L59), E31 (= E60), K32 (≠ A61), E38 (≠ G67), A39 (= A68), S40 (= S69), A43 (≠ N72), G45 (= G74), L46 (≠ Q75), V171 (= V211), G200 (≠ C238), G201 (≠ N239), W203 (≠ Y241), G298 (= G341), R300 (≠ I343), P301 (≠ G344), Y326 (≠ A369), R327 (≠ G370), N328 (≠ H371), G329 (= G372), I330 (≠ L373)
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
23% identity, 63% coverage: 31:302/430 of query aligns to 43:303/857 of Q63342
- CV 52:53 (≠ FS 40:41) binding
- EK 73:74 (≠ EA 60:61) binding
- 80:88 (vs. 67:75, 22% identical) binding
- H84 (≠ R71) modified: Tele-8alpha-FAD histidine
- V212 (= V211) binding
- W244 (≠ Y241) binding
Sites not aligning to the query:
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
23% identity, 63% coverage: 31:302/430 of query aligns to 6:266/824 of 4pabB
- active site: T53 (≠ I77), E102 (≠ G149), H226 (≠ S258), Y255 (= Y290)
- binding flavin-adenine dinucleotide: I11 (≠ V36), G12 (= G37), G14 (= G39), C15 (≠ F40), V16 (≠ S41), L35 (= L59), E36 (= E60), K37 (≠ A61), G43 (= G67), S44 (≠ A68), T45 (≠ S69), H47 (≠ R71), A48 (≠ N72), A49 (≠ G73), G50 (= G74), L51 (≠ Q75), V175 (= V211), A204 (≠ C238), G205 (≠ N239), W207 (≠ Y241), H226 (≠ S258), Y228 (≠ I260)
Sites not aligning to the query:
- active site: 536
- binding flavin-adenine dinucleotide: 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
25% identity, 50% coverage: 31:246/430 of query aligns to 17:230/433 of 5hxwA
- active site: F58 (≠ N72), Q61 (= Q75), A62 (≠ L76)
- binding flavin-adenine dinucleotide: V22 (= V36), G23 (= G37), G25 (= G39), I26 (≠ F40), L27 (≠ S41), E46 (= E60), K47 (≠ A61), E53 (≠ G67), Q54 (≠ A68), S55 (= S69), R57 (= R71), F58 (≠ N72), Y59 (≠ G73), G60 (= G74), Q61 (= Q75), A188 (≠ E210), A189 (≠ V211), G218 (vs. gap), G219 (vs. gap), W221 (vs. gap)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
Query Sequence
>GFF5415 FitnessBrowser__WCS417:GFF5415
MTASARHTPSYYAASSVAQPDYPVLTGDMTADVCVVGGGFSGLNTALELAERGFSVVLLE
ARKIAWGASGRNGGQLIRGVGHGLDQFANVIGTEGVRQMKLMGLEAVEIVRERVERFQIP
CDLTWGYCDLANKSRDLQGLAEDAEELRGLGYRHEVRLLHADQMSSVIGSDRYVGGMIDM
GSGHLHPLNLALGEAAAAQQLGVKLFEQSEVTRIDYGPEVNVHTAQGNVRAKTLVLACNA
YLNDLNPRLSGKVLPAGSYIIATEPLSEAQAVDLLPQNMAVCDQRVTVDYFRLSADRRLL
FGGACHYSGRDPKDIGAYMRPKMLQVFPQLADVKIDYQWGGMIGIGANRLPQIGRLTDQP
NVYYAQAYAGHGLNATHLAGKLLAEAISGQQQGRFDLFAQVPHITFPGGKHLRSPLLALG
MLWHRLKERM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory