Comparing GFF5498 FitnessBrowser__WCS417:GFF5498 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A962 L-asparaginase 1; L-asparaginase I; L-ASNase I; L-asparagine amidohydrolase I; EC 3.5.1.1 from Escherichia coli (strain K12) (see paper)
37% identity, 99% coverage: 4:324/325 of query aligns to 3:334/338 of P0A962
6nxcB Ecai(t162a) mutant in complex with citrate at ph 4 (see paper)
36% identity, 99% coverage: 4:324/325 of query aligns to 10:333/336 of 6nxcB
2himA Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i (see paper)
36% identity, 99% coverage: 4:324/325 of query aligns to 1:322/324 of 2himA
7r6bB Crystal structure of mutant r43d/l124d/r125a/c273s of l-asparaginase i from yersinia pestis (see paper)
35% identity, 99% coverage: 4:324/325 of query aligns to 1:299/301 of 7r6bB
5ot0A The thermostable l-asparaginase from thermococcus kodakarensis (see paper)
33% identity, 98% coverage: 6:324/325 of query aligns to 2:325/328 of 5ot0A
4r8lA Crystal structure of the asp-bound guinea pig l-asparaginase 1 catalytic domain (see paper)
31% identity, 98% coverage: 6:324/325 of query aligns to 3:351/354 of 4r8lA
4q0mA Crystal structure of pyrococcus furiosus l-asparaginase (see paper)
32% identity, 83% coverage: 56:325/325 of query aligns to 51:326/327 of 4q0mA
Sites not aligning to the query:
Q8TZE8 L-asparaginase; EC 3.5.1.1 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 2 papers)
32% identity, 83% coverage: 56:325/325 of query aligns to 50:325/326 of Q8TZE8
Sites not aligning to the query:
5dndD Crystal structure of the asn-bound guinea pig l-asparaginase 1 catalytic domain active site mutant t116a (see paper)
31% identity, 98% coverage: 6:324/325 of query aligns to 3:351/357 of 5dndD
1zq1A Structure of gatde tRNA-dependent amidotransferase from pyrococcus abyssi (see paper)
28% identity, 98% coverage: 7:324/325 of query aligns to 93:426/437 of 1zq1A
4njeA Crystal structure of pyrococcus furiosus l-asparaginase with ligand (see paper)
38% identity, 37% coverage: 56:175/325 of query aligns to 50:167/182 of 4njeA
Sites not aligning to the query:
5b5uA Crystal structure of truncated pyrococcus furiosus l-asparaginase with peptide (see paper)
38% identity, 37% coverage: 56:175/325 of query aligns to 50:167/175 of 5b5uA
Sites not aligning to the query:
1hg1A X-ray structure of the complex between erwinia chrysanthemi l-asparaginase and d-aspartate (see paper)
26% identity, 82% coverage: 6:271/325 of query aligns to 3:266/306 of 1hg1A
2wltA The crystal structure of helicobacter pylori l-asparaginase at 1.4 a resolution (see paper)
27% identity, 82% coverage: 7:271/325 of query aligns to 4:285/326 of 2wltA
1hfwA X-ray structure of the complex between erwinia chrysanthemi l-asparaginase and l-glutamate (see paper)
26% identity, 82% coverage: 6:271/325 of query aligns to 4:267/307 of 1hfwA
P06608 L-asparaginase; L-ASNase; L-asparagine amidohydrolase; EC 3.5.1.1 from Dickeya chrysanthemi (Pectobacterium chrysanthemi) (Erwinia chrysanthemi) (see 2 papers)
27% identity, 82% coverage: 6:271/325 of query aligns to 27:308/348 of P06608
1jsrA Crystal structure of erwinia chrysanthemi l-asparaginase complexed with 6-hydroxy-l-norleucine (see paper)
27% identity, 82% coverage: 6:271/325 of query aligns to 3:284/324 of 1jsrA
1jslA Crystal structure of erwinia chrysanthemi l-asparaginase complexed with 6-hydroxy-d-norleucine (see paper)
27% identity, 82% coverage: 6:271/325 of query aligns to 3:284/324 of 1jslA
1hg0A X-ray structure of the complex between erwinia chrysanthemi l- asparaginase and succinic acid (see paper)
27% identity, 82% coverage: 6:271/325 of query aligns to 6:287/327 of 1hg0A
7u6mC Albumin binding domain fused to a mutant of the erwinia asparaginase (see paper)
26% identity, 82% coverage: 6:271/325 of query aligns to 21:302/342 of 7u6mC
>GFF5498 FitnessBrowser__WCS417:GFF5498
MSSSSNVMVLYTGGTIGMQASTHGLAPASGFEARMREQLAHLPAPAWRFQEMAPLIDSAN
MTPAYWQRLRTAVVEAVDDGCDAVLILHGTDTLAYSAAAMSFQLLGLPAPVVFTGSMLPA
GVPDSDAWENVSGALAALGKGIAPGVHLYFHGALMAPTRCAKIRSFGRNPFAALNRQGGA
ARAESIPQALDYRQPKALASVGVLPLVPGIGAAQLDAVIGSGIQALILECFGSGTGPSDN
PEFLASLQRAQDQGVVVVAITQCHEGGVELDVYEAGSRLRGVGVLSGGGMTREAAFGKLN
ALIGAGLDTQEVRRLVELDLCGELR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory