Comparing GFF5534 FitnessBrowser__WCS417:GFF5534 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
44% identity, 72% coverage: 26:123/137 of query aligns to 9:107/200 of 6j2lA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
37% identity, 77% coverage: 19:124/137 of query aligns to 4:109/213 of 7bgmA
Sites not aligning to the query:
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
37% identity, 77% coverage: 19:124/137 of query aligns to 2:107/204 of 7bgnA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
42% identity, 72% coverage: 26:123/137 of query aligns to 8:100/185 of 6j2lB
Sites not aligning to the query:
>GFF5534 FitnessBrowser__WCS417:GFF5534
MTLSMLDLEGAAVGSRFPLEPVLDALPWNRDGLIAAIAQQHGSGEVLMLAWMNRQALKET
LDTGQVCYWSRSRQQLWRKGESSGHWQQLVEARLDCDGDAVLLIVDQQGTACHTGRPTCF
YNAIDGDYVHIITEPLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory