Comparing GFF554 FitnessBrowser__psRCH2:GFF554 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A6VCX3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.- from Pseudomonas aeruginosa (strain PA7) (see paper)
63% identity, 90% coverage: 17:184/187 of query aligns to 1:168/172 of A6VCX3
2j8mA Structure of p. Aeruginosa acetyltransferase pa4866 (see paper)
63% identity, 89% coverage: 18:184/187 of query aligns to 1:167/171 of 2j8mA
2j8rA Structure of p. Aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine (see paper)
64% identity, 88% coverage: 21:184/187 of query aligns to 3:166/170 of 2j8rA
3dr8A Structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
59% identity, 91% coverage: 18:187/187 of query aligns to 2:170/173 of 3dr8A
Q8ZPD3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; L-amino acid N-acyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.-; EC 2.3.1.- from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
59% identity, 90% coverage: 19:187/187 of query aligns to 1:168/171 of Q8ZPD3
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
53% identity, 88% coverage: 17:181/187 of query aligns to 2:165/165 of 4jwpA
2jlmF Structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1 (see paper)
44% identity, 83% coverage: 32:187/187 of query aligns to 22:177/180 of 2jlmF
4mbuA Crystal structure of n-acetyltransferase from staphylococcus aureus mu50 (see paper)
40% identity, 88% coverage: 18:181/187 of query aligns to 2:164/165 of 4mbuA
4jxrB Crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
37% identity, 89% coverage: 17:182/187 of query aligns to 1:166/185 of 4jxrB
5dwnA Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa
39% identity, 89% coverage: 21:187/187 of query aligns to 6:175/181 of 5dwnA
5t7eD Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with coenzyme a and l-phosphinothricin (see paper)
34% identity, 87% coverage: 21:182/187 of query aligns to 4:163/175 of 5t7eD
5t7dA Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a (see paper)
34% identity, 87% coverage: 21:182/187 of query aligns to 3:162/173 of 5t7dA
5wphA Crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 (see paper)
36% identity, 84% coverage: 18:174/187 of query aligns to 1:155/179 of 5wphA
6m7gA Crystal structure of arsn, n-acetyltransferase with substrate phosphinothricin from pseudomonas putida kt2440 (see paper)
36% identity, 84% coverage: 18:174/187 of query aligns to 1:155/176 of 6m7gA
6e1xA Crystal structure of product-bound complex of spermidine/spermine n- acetyltransferase speg
26% identity, 47% coverage: 99:186/187 of query aligns to 81:169/170 of 6e1xA
Sites not aligning to the query:
4r87A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with coa and spermine (see paper)
26% identity, 47% coverage: 99:186/187 of query aligns to 81:169/170 of 4r87A
Sites not aligning to the query:
4r57A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with acetyl-coa (see paper)
26% identity, 47% coverage: 99:186/187 of query aligns to 81:169/170 of 4r57A
Sites not aligning to the query:
4nczA Spermidine n-acetyltransferase from vibrio cholerae in complex with 2- [n-cyclohexylamino]ethane sulfonate. (see paper)
26% identity, 47% coverage: 99:186/187 of query aligns to 81:169/170 of 4nczA
Sites not aligning to the query:
4mi4A Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermine (see paper)
26% identity, 47% coverage: 99:186/187 of query aligns to 81:169/170 of 4mi4A
Sites not aligning to the query:
4mhdA Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermidine (see paper)
26% identity, 47% coverage: 99:186/187 of query aligns to 81:169/170 of 4mhdA
Sites not aligning to the query:
>GFF554 FitnessBrowser__psRCH2:GFF554
MSVNVYCEDPRPALKELNVQIRDALDADLEGILHIYNDAVLNSTAIWNDHTVDLDNRRAW
LAERHAQHYPVLVAIDEQGRVAGYASFGPWRPHDGFRHTVENSVYVSPDHRGSGIGRSLM
KALIERARVLEKHVMVAFIESENRASVHMHQQLGFIHVGQMRQVGCKFGRWLDLTMMQLT
LNRTSNP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory