SitesBLAST
Comparing GFF559 FitnessBrowser__psRCH2:GFF559 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 85% coverage: 42:282/283 of query aligns to 4:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 85% coverage: 42:282/283 of query aligns to 4:253/253 of 1g9xB
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 82% coverage: 42:274/283 of query aligns to 4:231/280 of 5x40A
- binding phosphomethylphosphonic acid adenylate ester: F14 (= F52), V18 (≠ F55), A20 (= A57), N40 (= N77), G41 (= G78), G43 (= G80), K44 (= K81), S45 (≠ T82), T46 (= T83), Q88 (≠ K123), H139 (≠ G183), M140 (≠ L184), L141 (= L185), S142 (= S186), G144 (= G188), Q145 (= Q189), Q166 (≠ E210), H198 (= H241)
- binding magnesium ion: S45 (≠ T82), Q88 (≠ K123)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
30% identity, 86% coverage: 42:283/283 of query aligns to 4:240/501 of P04983
- K43 (= K81) mutation to R: Loss of transport.
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 76% coverage: 55:270/283 of query aligns to 18:228/343 of P30750
- 40:46 (vs. 77:83, 71% identical) binding
- E166 (= E210) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
28% identity, 86% coverage: 41:282/283 of query aligns to 1:235/240 of 6mjpA
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 79% coverage: 43:265/283 of query aligns to 4:216/369 of P19566
- L86 (≠ V129) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P211) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D217) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 76% coverage: 55:270/283 of query aligns to 19:229/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 76% coverage: 55:270/283 of query aligns to 19:229/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 76% coverage: 55:270/283 of query aligns to 19:229/344 of 6cvlD
- binding phosphothiophosphoric acid-adenylate ester: I19 (≠ F55), S41 (≠ N77), G42 (= G78), A43 (= A79), G44 (= G80), K45 (= K81), S46 (≠ T82), T47 (= T83), N141 (≠ L184), S143 (= S186), Q146 (= Q189), H200 (= H241)
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
30% identity, 85% coverage: 43:282/283 of query aligns to 3:235/235 of 6mhzA
- binding adp orthovanadate: Y12 (≠ F52), N37 (= N77), G38 (= G78), G40 (= G80), K41 (= K81), T42 (= T82), T43 (= T83), Q84 (= Q125), S136 (≠ L184), S138 (= S186), G139 (≠ H187), G140 (= G188), E162 (= E210), G166 (= G214), H194 (≠ M243)
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
30% identity, 85% coverage: 43:282/283 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
30% identity, 85% coverage: 43:282/283 of query aligns to 3:235/238 of 6s8gA
- binding phosphoaminophosphonic acid-adenylate ester: Y12 (≠ F52), R15 (≠ F55), N37 (= N77), G40 (= G80), K41 (= K81), T42 (= T82), T43 (= T83), Q84 (= Q125), S136 (≠ L184), S138 (= S186), E141 (≠ Q189)
6mbnA Lptb e163q in complex with atp (see paper)
30% identity, 85% coverage: 43:282/283 of query aligns to 4:236/241 of 6mbnA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
30% identity, 81% coverage: 42:271/283 of query aligns to 4:224/285 of 4yerA
- binding adenosine-5'-diphosphate: F14 (= F52), F17 (= F55), N39 (= N77), G40 (= G78), G42 (= G80), K43 (= K81), T44 (= T82), T45 (= T83), T135 (≠ L184), F136 (≠ L185), S137 (= S186)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
31% identity, 79% coverage: 43:265/283 of query aligns to 3:215/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
31% identity, 79% coverage: 43:265/283 of query aligns to 1:213/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F52), S35 (≠ N77), G36 (= G78), C37 (≠ A79), G38 (= G80), K39 (= K81), S40 (≠ T82), T41 (= T83), R126 (= R180), A130 (≠ L184), S132 (= S186), G134 (= G188), Q135 (= Q189)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 79% coverage: 43:265/283 of query aligns to 4:216/371 of P68187
- A85 (≠ T128) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ Q161) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ I165) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (= V168) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E170) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ G175) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G188) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D209) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
31% identity, 79% coverage: 43:265/283 of query aligns to 3:215/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F52), S37 (≠ N77), G38 (= G78), C39 (≠ A79), G40 (= G80), K41 (= K81), S42 (≠ T82), T43 (= T83), Q81 (= Q125), R128 (= R180), A132 (≠ L184), S134 (= S186), G136 (= G188), Q137 (= Q189), E158 (= E210), H191 (= H241)
- binding magnesium ion: S42 (≠ T82), Q81 (= Q125)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
31% identity, 79% coverage: 43:265/283 of query aligns to 3:215/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F52), G38 (= G78), C39 (≠ A79), G40 (= G80), K41 (= K81), S42 (≠ T82), T43 (= T83), R128 (= R180), S134 (= S186), Q137 (= Q189)
- binding beryllium trifluoride ion: S37 (≠ N77), G38 (= G78), K41 (= K81), Q81 (= Q125), S134 (= S186), G136 (= G188), H191 (= H241)
- binding magnesium ion: S42 (≠ T82), Q81 (= Q125)
Query Sequence
>GFF559 FitnessBrowser__psRCH2:GFF559
MKTVPCSAVIDGFDPTGGGLTRDAIGLGRVAEKGLDVRHGTILSLEDINVSFDGFKALTD
LSLYIGVGELRCIIGPNGAGKTTMMDVITGKTRPTSGSAWFGETLDLTRMSEVDIAQAGI
GRKFQKPTVFEALSVFENLELAQKTDKSVWASLRAKLSGEQKDRIDEVLETIRLGQSRHR
PAGLLSHGQKQFLEIGMLLMQSPQLLLLDEPVAGMTDAETEFTAELFKSLARKHSLMVVE
HDMGFVETIADHVTVLHQGQVLAEGSLQQVQADERVIEVYLGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory