Comparing GFF617 FitnessBrowser__Phaeo:GFF617 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
57% identity, 99% coverage: 1:459/462 of query aligns to 2:461/464 of 4f4fA
1kl7A Crystal structure of threonine synthase from yeast (see paper)
44% identity, 91% coverage: 3:421/462 of query aligns to 7:459/509 of 1kl7A
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
42% identity, 91% coverage: 1:421/462 of query aligns to 5:462/514 of Q42598
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
39% identity, 92% coverage: 1:423/462 of query aligns to 5:442/496 of 8g1yA
1vb3A Crystal structure of threonine synthase from escherichia coli
32% identity, 99% coverage: 1:459/462 of query aligns to 1:427/428 of 1vb3A
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
24% identity, 66% coverage: 108:414/462 of query aligns to 124:403/444 of 2c2bA
Sites not aligning to the query:
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 66% coverage: 108:414/462 of query aligns to 199:478/526 of Q9S7B5
Sites not aligning to the query:
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
26% identity, 38% coverage: 108:283/462 of query aligns to 142:312/448 of 2c2gA
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
28% identity, 39% coverage: 85:262/462 of query aligns to 43:203/360 of A0R220
>GFF617 FitnessBrowser__Phaeo:GFF617
MKYISTRGQAPELTFEDAMLTGLARDGGLYVPAEIPTMSKDEIAALAGLSYEEVAFRVMR
PFLGDCFTDEEFRGIIARAYDGFGHAARAPLVQLAPNHFLLELFHGPTLAFKDFAMQLIG
QLFETALKRRGESVTIVGATSGDTGSAAIQAFGGLDAVNVFILYPHGRVSEVQRRQMTTP
TDANVHALAVDGDFDDCQAALKDMFNDFDFRDEVRLAGVNSINFARVLAQVVYYFTSAVS
LGAPERKVSFTVPTGNFGDIFAGFIAKQMGLPIDQLVVATNQNDILHRCLSGQGYHKGET
IPSISPSMDIQVSSNFERALFYACGQDGAAVAQLMDELKSGGFEVSQGAMQALQEHYVSG
RCSEEETSATIKSERAASGELLCPHSAIGVKVANEQRDAAVPMVTLATAHPAKFPAAVEE
ASGIHPPLPPRMADLYDRSERVTRIANDLTTLETHIRKHIAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory