Comparing GFF618 FitnessBrowser__Marino:GFF618 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
38% identity, 97% coverage: 10:415/418 of query aligns to 5:409/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
38% identity, 97% coverage: 10:415/418 of query aligns to 5:409/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
31% identity, 98% coverage: 2:411/418 of query aligns to 3:408/412 of 4jbeB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
26% identity, 70% coverage: 109:399/418 of query aligns to 101:425/455 of 5j7iC
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
26% identity, 70% coverage: 109:399/418 of query aligns to 102:426/456 of 5j7iB
3rhhD Crystal structure of NADP-dependent glyceraldehyde-3-phosphate dehydrogenase from bacillus halodurans c-125 complexed with NADP
25% identity, 65% coverage: 114:384/418 of query aligns to 142:456/480 of 3rhhD
8cekA Succinyl-coa reductase from clostridium kluyveri (sucd) with NADPH (see paper)
28% identity, 29% coverage: 164:286/418 of query aligns to 147:262/449 of 8cekA
Sites not aligning to the query:
8cejC Succinyl-coa reductase from clostridium kluyveri (sucd) with mesaconyl-c1-coa (see paper)
28% identity, 29% coverage: 164:286/418 of query aligns to 147:262/449 of 8cejC
Sites not aligning to the query:
8cejA Succinyl-coa reductase from clostridium kluyveri (sucd) with mesaconyl-c1-coa (see paper)
28% identity, 29% coverage: 164:286/418 of query aligns to 147:262/449 of 8cejA
Sites not aligning to the query:
>GFF618 FitnessBrowser__Marino:GFF618
MDIAAYMAEVGQQARAAATGVARSTTAVRNQALLATAEALDAAREELALANGKDLQMGRE
NGLDAAMLDRLELTPQRIDTMIEGLRQVASLPDPIGAITDMNYRPSGIQVGKMRVPLGVI
GIIYESRPNVTVEAASLCLKSGNATILRGGSESIHSNQAIARCLSAGLAKAGLPENAVQV
IKTTDRAAVGELITMPDYVDVIVPRGGKGLIERISRDARVPVIKHLDGVCHVYIDSHADP
EKALKVAINAKTHRYGTCNTMETLLVDAEIAEDILPLLAQAFVEKGVELRGCERTRAIVE
GVVEATEADWEAEYLAPVLAVRVVDGLEGAIAHINRYSSQHTDSIITENYTRARRFITEV
DSSSVMVNASTRFADGFEYGLGAEIGISTDKIHARGPVGLEGLTSQKYVVFGDGHIRT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory