SitesBLAST
Comparing GFF620 FitnessBrowser__Phaeo:GFF620 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
45% identity, 93% coverage: 30:470/474 of query aligns to 29:465/465 of 3pm9A
- active site: A149 (= A153), L159 (≠ N163)
- binding flavin-adenine dinucleotide: P69 (= P70), Q70 (≠ Y71), G71 (= G72), G72 (= G73), N73 (≠ G74), T74 (= T75), G75 (= G76), L76 (= L77), G79 (= G80), Q80 (= Q81), L91 (= L95), L133 (= L137), G134 (≠ A138), A135 (= A139), C139 (≠ A143), T140 (≠ R144), G142 (= G146), G143 (= G147), S146 (≠ A150), T147 (= T151), A149 (= A153), G150 (= G154), E200 (= E204), G201 (= G205), I205 (= I209), I206 (= I210), E423 (= E428)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 97% coverage: 7:466/474 of query aligns to 28:492/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
36% identity, 94% coverage: 26:471/474 of query aligns to 28:466/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (≠ Y38), P76 (= P70), G78 (= G72), G79 (= G73), N80 (≠ G74), T81 (= T75), G82 (= G76), M83 (≠ L77), G86 (= G80), S87 (≠ Q81), L140 (= L137), A142 (= A139), C146 (≠ A143), H147 (≠ R144), G150 (= G147), N151 (≠ T148), A153 (= A150), T154 (= T151), G208 (= G205), I212 (= I209), I213 (= I210), E423 (= E428), N460 (= N465)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
36% identity, 94% coverage: 26:471/474 of query aligns to 27:465/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R333), T337 (≠ P337), K348 (≠ S348), Y379 (≠ F380), H381 (= H382), H388 (= H389), H423 (= H429)
- binding flavin-adenine dinucleotide: W39 (≠ Y38), P75 (= P70), Q76 (≠ Y71), G77 (= G72), G78 (= G73), N79 (≠ G74), T80 (= T75), G81 (= G76), M82 (≠ L77), G85 (= G80), S86 (≠ Q81), L139 (= L137), G140 (≠ A138), A141 (= A139), C145 (≠ A143), G149 (= G147), N150 (≠ T148), A152 (= A150), T153 (= T151), G157 (= G155), G207 (= G205), I212 (= I210), E422 (= E428), N459 (= N465)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E428)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
36% identity, 94% coverage: 26:471/474 of query aligns to 27:465/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (≠ Y38), P75 (= P70), G77 (= G72), G78 (= G73), N79 (≠ G74), T80 (= T75), G81 (= G76), G85 (= G80), S86 (≠ Q81), L139 (= L137), G140 (≠ A138), A141 (= A139), C145 (≠ A143), H146 (≠ R144), G148 (= G146), G149 (= G147), N150 (≠ T148), A152 (= A150), T153 (= T151), A155 (= A153), E206 (= E204), G207 (= G205), I211 (= I209), I212 (= I210), E422 (= E428), N459 (= N465)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R333), T337 (≠ P337), K348 (≠ S348), Y379 (≠ F380), H381 (= H382), H388 (= H389), H423 (= H429)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E428)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
36% identity, 94% coverage: 26:471/474 of query aligns to 27:465/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (≠ Y38), P75 (= P70), G77 (= G72), G78 (= G73), N79 (≠ G74), T80 (= T75), G81 (= G76), G85 (= G80), S86 (≠ Q81), L139 (= L137), G140 (≠ A138), A141 (= A139), C145 (≠ A143), H146 (≠ R144), G149 (= G147), N150 (≠ T148), A152 (= A150), T153 (= T151), A155 (= A153), G157 (= G155), E206 (= E204), G207 (= G205), I211 (= I209), I212 (= I210), E422 (= E428), N459 (= N465)
- binding d-malate: M82 (≠ L77), R333 (= R333), T337 (≠ P337), K348 (≠ S348), Y379 (≠ F380), H381 (= H382), H388 (= H389), E422 (= E428), H423 (= H429)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E428)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
36% identity, 94% coverage: 26:471/474 of query aligns to 27:465/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R333), T337 (≠ P337), K348 (≠ S348), Y379 (≠ F380), H381 (= H382), H388 (= H389), N390 (= N391), H423 (= H429)
- binding flavin-adenine dinucleotide: W39 (≠ Y38), P75 (= P70), G77 (= G72), G78 (= G73), N79 (≠ G74), T80 (= T75), G81 (= G76), M82 (≠ L77), G85 (= G80), S86 (≠ Q81), L139 (= L137), G140 (≠ A138), A141 (= A139), C145 (≠ A143), G149 (= G147), N150 (≠ T148), A152 (= A150), T153 (= T151), A155 (= A153), G157 (= G155), G207 (= G205), I212 (= I210), E422 (= E428), H423 (= H429)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E428)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
36% identity, 94% coverage: 26:471/474 of query aligns to 80:518/521 of Q8N465
- S109 (≠ T51) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V69) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G73) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V92) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M98) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ M117) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P134) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A150) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P176) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G178) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S322) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R333) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ P337) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (= V346) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ S348) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ G366) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G373) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H382) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G384) to V: slight reduction in catalytic activity
- N439 (= N387) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H389) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N391) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (= V392) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ R400) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E428) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H429) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G430) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 89% coverage: 50:473/474 of query aligns to 53:467/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P70), G75 (= G72), S76 (≠ G73), G77 (= G74), T78 (= T75), G79 (= G76), L80 (= L77), A83 (≠ G80), C84 (≠ Q81), P137 (≠ A138), G138 (≠ A139), E139 (= E140), A142 (= A143), T143 (≠ R144), G146 (= G147), N147 (≠ T148), S149 (≠ A150), T150 (= T151), A152 (= A153), G153 (= G154), E203 (= E204), G204 (= G205), I209 (= I210), E422 (= E428), H423 (= H429)
- binding fe (iii) ion: H377 (= H382), H384 (= H389), E422 (= E428)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 89% coverage: 46:469/474 of query aligns to 44:455/459 of P9WIT1
- K354 (≠ D360) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
28% identity, 97% coverage: 10:470/474 of query aligns to 5:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (= E33), P68 (= P70), G70 (= G72), T71 (≠ G73), G72 (= G74), T73 (= T75), G74 (= G76), G78 (= G80), V79 (≠ Q81), L90 (= L95), P132 (≠ L137), G133 (≠ A138), A134 (= A139), G140 (= G147), M141 (≠ T148), A143 (= A150), T144 (= T151), A146 (= A153), S147 (≠ G154), E200 (= E204), G201 (= G205), I206 (= I210), W322 (≠ P337), E413 (= E428), H414 (= H429), N450 (= N465)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R333), H369 (= H382), H376 (= H389), H414 (= H429)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E428)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
28% identity, 97% coverage: 10:470/474 of query aligns to 5:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L77), R317 (= R333), W321 (≠ P337), H368 (= H382), H375 (= H389), H413 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (= G72), T71 (≠ G73), G72 (= G74), T73 (= T75), G74 (= G76), G78 (= G80), V79 (≠ Q81), L90 (= L95), P132 (≠ L137), G133 (≠ A138), A134 (= A139), G140 (= G147), M141 (≠ T148), A143 (= A150), T144 (= T151), A146 (= A153), S147 (≠ G154), E200 (= E204), G201 (= G205), I206 (= I210), W321 (≠ P337), Y322 (≠ E338), E412 (= E428), H413 (= H429), N449 (= N465)
- binding manganese (ii) ion: H368 (= H382), H375 (= H389), E412 (= E428)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
28% identity, 97% coverage: 10:470/474 of query aligns to 5:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R333), W322 (≠ P337), H369 (= H382), H376 (= H389), H413 (= H429)
- binding flavin-adenine dinucleotide: E32 (= E33), P68 (= P70), G70 (= G72), T71 (≠ G73), G72 (= G74), T73 (= T75), G74 (= G76), G78 (= G80), V79 (≠ Q81), L90 (= L95), P132 (≠ L137), G133 (≠ A138), A134 (= A139), G140 (= G147), M141 (≠ T148), A143 (= A150), T144 (= T151), A146 (= A153), S147 (≠ G154), E200 (= E204), G201 (= G205), I206 (= I210), W322 (≠ P337), E412 (= E428), H413 (= H429), N449 (= N465)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E412 (= E428)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
28% identity, 97% coverage: 10:470/474 of query aligns to 5:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R333), W322 (≠ P337), S336 (= S348), H369 (= H382), H376 (= H389), H413 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (= G72), T71 (≠ G73), G72 (= G74), T73 (= T75), G74 (= G76), G78 (= G80), V79 (≠ Q81), L90 (= L95), P132 (≠ L137), G133 (≠ A138), A134 (= A139), G140 (= G147), M141 (≠ T148), A143 (= A150), T144 (= T151), A146 (= A153), S147 (≠ G154), E200 (= E204), G201 (= G205), I206 (= I210), E412 (= E428), N449 (= N465)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E412 (= E428)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
28% identity, 97% coverage: 10:470/474 of query aligns to 5:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (= G72), T71 (≠ G73), G72 (= G74), T73 (= T75), G74 (= G76), G78 (= G80), V79 (≠ Q81), L90 (= L95), P132 (≠ L137), G133 (≠ A138), A134 (= A139), G140 (= G147), M141 (≠ T148), A143 (= A150), T144 (= T151), A146 (= A153), S147 (≠ G154), E200 (= E204), G201 (= G205), I206 (= I210), W322 (≠ P337), E413 (= E428), H414 (= H429), N450 (= N465)
- binding lactic acid: R318 (= R333), H369 (= H382), H376 (= H389), H414 (= H429)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E428)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
28% identity, 97% coverage: 10:470/474 of query aligns to 5:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R333), W322 (≠ P337), H369 (= H382), H376 (= H389), H414 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (= G72), T71 (≠ G73), G72 (= G74), T73 (= T75), G74 (= G76), G78 (= G80), V79 (≠ Q81), L90 (= L95), P132 (≠ L137), G133 (≠ A138), A134 (= A139), G140 (= G147), M141 (≠ T148), A143 (= A150), T144 (= T151), A146 (= A153), S147 (≠ G154), E200 (= E204), G201 (= G205), I206 (= I210), W322 (≠ P337), E413 (= E428), N450 (= N465)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E428)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
28% identity, 97% coverage: 10:470/474 of query aligns to 5:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R333), H369 (= H382), H376 (= H389), H414 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (= G72), T71 (≠ G73), G72 (= G74), T73 (= T75), G74 (= G76), G78 (= G80), V79 (≠ Q81), L90 (= L95), P132 (≠ L137), G133 (≠ A138), A134 (= A139), G140 (= G147), M141 (≠ T148), A143 (= A150), T144 (= T151), A146 (= A153), S147 (≠ G154), E200 (= E204), G201 (= G205), I206 (= I210), W322 (≠ P337), E413 (= E428), H414 (= H429), N450 (= N465)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E428)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
28% identity, 97% coverage: 10:470/474 of query aligns to 5:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (= E33), P68 (= P70), G70 (= G72), T71 (≠ G73), G72 (= G74), T73 (= T75), G74 (= G76), G78 (= G80), V79 (≠ Q81), L90 (= L95), P132 (≠ L137), G133 (≠ A138), A134 (= A139), G140 (= G147), M141 (≠ T148), A143 (= A150), T144 (= T151), A146 (= A153), S147 (≠ G154), E200 (= E204), G201 (= G205), I206 (= I210), W323 (≠ P337), E414 (= E428), H415 (= H429), N451 (= N465)
- binding manganese (ii) ion: H370 (= H382), H377 (= H389), E414 (= E428)
- binding pyruvic acid: R319 (= R333), H370 (= H382), H377 (= H389), H415 (= H429)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
28% identity, 97% coverage: 10:470/474 of query aligns to 5:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (= G72), T71 (≠ G73), G72 (= G74), T73 (= T75), G74 (= G76), G78 (= G80), V79 (≠ Q81), L90 (= L95), P132 (≠ L137), G133 (≠ A138), A134 (= A139), G140 (= G147), M141 (≠ T148), A143 (= A150), T144 (= T151), A146 (= A153), S147 (≠ G154), E200 (= E204), G201 (= G205), I206 (= I210), H369 (= H382), E413 (= E428), N450 (= N465)
- binding deaminohydroxyvaline: R319 (= R333), H414 (= H429)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
28% identity, 97% coverage: 10:470/474 of query aligns to 5:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P70), G70 (= G72), T71 (≠ G73), G72 (= G74), T73 (= T75), G74 (= G76), G78 (= G80), V79 (≠ Q81), L90 (= L95), P132 (≠ L137), G133 (≠ A138), A134 (= A139), G140 (= G147), M141 (≠ T148), A143 (= A150), T144 (= T151), A146 (= A153), S147 (≠ G154), E200 (= E204), G201 (= G205), I206 (= I210), Y324 (≠ E338), H370 (= H382), E414 (= E428), N451 (= N465)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R333), W323 (≠ P337), H415 (= H429)
Query Sequence
>GFF620 FitnessBrowser__Phaeo:GFF620
MTLNPADTSFVDHLRAVLPADTLRPAEPRYLEEPRGRYQGQAGVIALPRSTEEVATLLRA
AHTARVPVVPYGGGTGLVGGQIMGAAGPAPLVISLERMTALRGVYPQENVIAVEAGMILA
EVQRAATEAGRLFPLSLAAEGTARIGGTLATNAGGVNVLRYGNARDLCLGLEAVLPNGEI
WQGLSRLRKDNTGYDLRNLLIGAEGTLGIITAASLKLSPIPAEQGTAMLTVASPVAAIDL
LAMARDQLGETISAFELIHRQGLEFLRETLPDLRLPFADLPDWCVLIDLGLPKGRSPADA
LAALFETALDAGLCADGVIAQSEAQRQALWSAREHIPEGNRRIGSVSSHDISIPISRIPD
FIFEGGKRLAALGDMRINCFGHLGDGNLHYNVFPAQGKDRRAYEHLRDDVKRCVHDLTHE
YDGSVSAEHGIGRLKVADLRRYGDPVKLAAMQAIKQALDPHGIMNPGAVVPLAD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory