Comparing GFF635 FitnessBrowser__psRCH2:GFF635 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5o5cB The crystal structure of dfoj, the desferrioxamine biosynthetic pathway lysine decarboxylase from the fire blight disease pathogen erwinia amylovora (see paper)
58% identity, 91% coverage: 33:494/507 of query aligns to 19:461/468 of 5o5cB
4obvC Ruminococcus gnavus tryptophan decarboxylase rumgna_01526 (alpha-fmt) (see paper)
31% identity, 85% coverage: 69:501/507 of query aligns to 55:469/471 of 4obvC
A7B1V0 Tryptophan decarboxylase; Trp decarboxylase; EC 4.1.1.105 from Mediterraneibacter gnavus (strain ATCC 29149 / DSM 114966 / JCM 6515 / VPI C7-9) (Ruminococcus gnavus) (see paper)
30% identity, 86% coverage: 69:504/507 of query aligns to 70:490/490 of A7B1V0
4obuA Ruminococcus gnavus tryptophan decarboxylase rumgna_01526 (apo) (see paper)
30% identity, 86% coverage: 69:504/507 of query aligns to 55:462/462 of 4obuA
Q05683 Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; EC 4.1.1.15 from Rattus norvegicus (Rat) (see 2 papers)
29% identity, 89% coverage: 48:497/507 of query aligns to 112:585/585 of Q05683
Sites not aligning to the query:
Q80WP8 Acidic amino acid decarboxylase GADL1; Aspartate 1-decarboxylase; ADC; Cysteine sulfinic acid decarboxylase; CSADC; Glutamate decarboxylase-like protein 1; EC 4.1.1.11; EC 4.1.1.29 from Mus musculus (Mouse) (see paper)
27% identity, 97% coverage: 1:494/507 of query aligns to 49:547/550 of Q80WP8
Q05329 Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; EC 4.1.1.15 from Homo sapiens (Human) (see 3 papers)
29% identity, 89% coverage: 48:497/507 of query aligns to 112:585/585 of Q05329
Sites not aligning to the query:
6enzA Crystal structure of mouse gadl1 (see paper)
29% identity, 85% coverage: 65:494/507 of query aligns to 55:484/487 of 6enzA
2jisB Human cysteine sulfinic acid decarboxylase (csad) in complex with plp.
31% identity, 84% coverage: 32:459/507 of query aligns to 27:448/487 of 2jisB
2okkA The x-ray crystal structure of the 65kda isoform of glutamic acid decarboxylase (gad65) (see paper)
28% identity, 88% coverage: 48:494/507 of query aligns to 25:481/483 of 2okkA
3vp6A Structural characterization of glutamic acid decarboxylase; insights into the mechanism of autoinactivation (see paper)
29% identity, 91% coverage: 36:494/507 of query aligns to 33:499/500 of 3vp6A
2okjB The x-ray crystal structure of the 67kda isoform of glutamic acid decarboxylase (gad67) (see paper)
28% identity, 91% coverage: 36:497/507 of query aligns to 33:502/504 of 2okjB
Q99259 Glutamate decarboxylase 1; 67 kDa glutamic acid decarboxylase; GAD-67; Glutamate decarboxylase 67 kDa isoform; EC 4.1.1.15 from Homo sapiens (Human) (see 4 papers)
28% identity, 91% coverage: 36:497/507 of query aligns to 125:594/594 of Q99259
Sites not aligning to the query:
6zekA Crystal structure of mouse csad (see paper)
31% identity, 80% coverage: 55:459/507 of query aligns to 37:439/476 of 6zekA
Q8RY79 Phenylacetaldehyde synthase; AtPAAS; 3,4-dihydroxyphenylacetaldehyde synthase; DHPAA synthase; Aromatic L-amino acid decarboxylase; Aromatic aldehyde synthase; AtAAS; EC 4.1.1.109; EC 4.1.1.107 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
26% identity, 80% coverage: 91:498/507 of query aligns to 81:488/490 of Q8RY79
P19113 Histidine decarboxylase; HDC; EC 4.1.1.22 from Homo sapiens (Human) (see 3 papers)
27% identity, 94% coverage: 26:500/507 of query aligns to 5:477/662 of P19113
4e1oC Human histidine decarboxylase complex with histidine methyl ester (hme) (see paper)
26% identity, 94% coverage: 26:500/507 of query aligns to 9:481/481 of 4e1oC
7eiyA Human histidine decarboxylase mutant y334f soaking with histidine
27% identity, 93% coverage: 26:498/507 of query aligns to 4:466/467 of 7eiyA
7xinA Crystal structure of dodc from pseudomonas
31% identity, 82% coverage: 76:492/507 of query aligns to 55:461/470 of 7xinA
4rlgD The clear crystal structure of pyridoxal-dependent decarboxylase from sphaerobacter thermophilus dsm 20745
33% identity, 76% coverage: 94:479/507 of query aligns to 79:454/470 of 4rlgD
>GFF635 FitnessBrowser__psRCH2:GFF635
MTPSSTVVPFAPGPVSNGLFTRSNHDDYRQLLQQGLNLVQQCLQRQQQPFSGILPQELAA
DFERVDLERPLGDAGAALRELDQLYLRDAVYFHHPRYVAHLNCPVVLPALLAEVLVSSLN
SSLDTWDQSAGGTLIEQRLIDWTCARIGLGSQADGVFTSGGTQSNLMGLLLAREHVCNRL
PDHGGNLRHGLPAEAAGLRIFASRASHFSVQKSAALLGLGYDAVRSIETDSAQCMSVPAL
AQALADCQRLGELPMAVVATAGTTDFGSIDPLPEIAALCQHYGVWLHVDAAYGGGLLVAP
RYRDWLAGIEHADSVTVDYHKSFFQPVSCSGFFVRQRQHLSYITHHADYLNPRSQTREGT
PNLVNKSIQTTRRFDALKLWLTLRILGAEHIGAMFEEVIDRAADTHRLLANDPAFEVFTP
RLSTLVFRFVAPGVANERLDEINREIRKAIFRSGAAVIAATVVEGRQYLKFTLLNPETTL
NDLRAIVELIRDHGARLLDELPTAANQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory