SitesBLAST
Comparing GFF644 FitnessBrowser__Phaeo:GFF644 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
C1DFH7 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Azotobacter vinelandii (strain DJ / ATCC BAA-1303) (see paper)
61% identity, 100% coverage: 1:340/340 of query aligns to 1:338/338 of C1DFH7
- D190 (= D191) binding
- E226 (= E227) binding
- E230 (= E231) binding
7rduA Crystal structure of campylobacter jejuni keto said reductoisomerase in complex with magnesium and oxidixized and reduced NADPH
63% identity, 97% coverage: 1:330/340 of query aligns to 2:329/329 of 7rduA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G24 (= G23), G26 (= G25), S27 (= S26), Q28 (= Q27), R48 (= R48), S51 (= S51), S53 (= S53), A81 (≠ M81), P82 (= P82), D83 (= D83), I89 (≠ T89), A107 (= A107), H108 (= H108), P130 (= P130), K131 (= K131), A132 (≠ G132)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G24 (= G23), F25 (≠ Y24), G26 (= G25), S27 (= S26), Q28 (= Q27), S51 (= S51), S53 (= S53), L80 (≠ T80), P82 (= P82), D83 (= D83), I89 (≠ T89), A107 (= A107), H108 (= H108)
7latA Campylobacter jejuni keto-acid reductoisomerase in complex with mg2+
63% identity, 97% coverage: 1:330/340 of query aligns to 2:329/329 of 7latA
4xiyA Crystal structure of ketol-acid reductoisomerase from azotobacter (see paper)
61% identity, 97% coverage: 1:330/340 of query aligns to 1:328/328 of 4xiyA
8cy8A Apo form cryo-em structure of campylobacter jejune ketol-acid reductoisommerase crosslinked by glutaraldehyde
59% identity, 97% coverage: 1:330/340 of query aligns to 1:312/312 of 8cy8A
P9WKJ7 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
54% identity, 97% coverage: 1:329/340 of query aligns to 3:329/337 of P9WKJ7
- D192 (= D191) binding ; binding
- E196 (= E195) binding
- E228 (= E227) binding
- E232 (= E231) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
C8WR67 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Alicyclobacillus acidocaldarius subsp. acidocaldarius (strain ATCC 27009 / DSM 446 / BCRC 14685 / JCM 5260 / KCTC 1825 / NBRC 15652 / NCIMB 11725 / NRRL B-14509 / 104-IA) (Bacillus acidocaldarius) (see paper)
56% identity, 99% coverage: 2:336/340 of query aligns to 3:334/344 of C8WR67
- YGSQ 25:28 (= YGSQ 24:27) binding
- R48 (= R48) binding ; mutation to P: Inversion of the cofactor specificity from NADPH to NADH.
- S52 (≠ A52) binding ; mutation to D: Inversion of the cofactor specificity from NADPH to NADH.
- DERQ 82:85 (≠ DELQ 83:86) binding
- G133 (= G134) binding
- D190 (= D191) binding
- E194 (= E195) binding
- E226 (= E227) binding
4tskA Ketol-acid reductoisomerase from alicyclobacillus acidocaldarius (see paper)
56% identity, 99% coverage: 2:336/340 of query aligns to 2:333/333 of 4tskA
- active site: K129 (= K131), D189 (= D191), E193 (= E195)
- binding magnesium ion: D189 (= D191), D189 (= D191), E193 (= E195), E193 (= E195), R246 (≠ D248), Y247 (= Y249), I249 (= I251), D251 (≠ N253), Q254 (≠ E256)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y24), G25 (= G25), S26 (= S26), Q27 (= Q27), L46 (= L47), R47 (= R48), S51 (≠ A52), L78 (≠ T80), L79 (≠ M81), P80 (= P82), D81 (= D83), H106 (= H108), P131 (= P133)
4ypoA Crystal structure of mycobacterium tuberculosis ketol-acid reductoisomerase in complex with mg2+ (see paper)
55% identity, 96% coverage: 3:329/340 of query aligns to 1:325/325 of 4ypoA
D0WGK0 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Slackia exigua (strain ATCC 700122 / DSM 15923 / CIP 105133 / JCM 11022 / KCTC 5966 / S-7) (see paper)
55% identity, 96% coverage: 3:329/340 of query aligns to 14:338/342 of D0WGK0
- YGSQ 35:38 (= YGSQ 24:27) binding
- R58 (= R48) binding
- S61 (= S51) binding ; mutation to D: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold decrease of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 2-fold increase of the catalytic efficiency for NADH; when associated with D-63.
- S63 (= S53) binding ; mutation to D: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold decrease of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 2-fold increase of the catalytic efficiency for NADH; when associated with D-61.
- DEIQ 93:96 (≠ DELQ 83:86) binding
- G144 (= G134) binding
- D201 (= D191) binding
- E205 (= E195) binding
- S262 (= S252) binding
4kqwA The structure of the slackia exigua kari in complex with NADP (see paper)
55% identity, 96% coverage: 3:329/340 of query aligns to 2:326/326 of 4kqwA
- active site: K129 (= K131), D189 (= D191), E193 (= E195)
- binding magnesium ion: D189 (= D191), E193 (= E195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y23 (= Y24), G24 (= G25), S25 (= S26), Q26 (= Q27), R46 (= R48), S49 (= S51), S51 (= S53), L78 (≠ T80), V79 (≠ M81), P80 (= P82), D81 (= D83), I83 (≠ L85), Q84 (= Q86), H106 (= H108), P131 (= P133), I249 (= I251), S250 (= S252)
8ep7C Crystal structure of the ketol-acid reductoisomerase from bacillus anthracis in complex with NADP
55% identity, 97% coverage: 1:331/340 of query aligns to 1:328/328 of 8ep7C
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y24), G25 (= G25), S26 (= S26), Q27 (= Q27), R47 (= R48), S51 (= S53), L78 (≠ T80), L79 (≠ M81), P80 (= P82), D81 (= D83), Q83 (≠ L85), V87 (≠ T89), H106 (= H108)
6jx2B Crystal structure of ketol-acid reductoisomerase from corynebacterium glutamicum (see paper)
55% identity, 97% coverage: 1:329/340 of query aligns to 1:327/327 of 6jx2B
4kqxB Mutant slackia exigua kari ddv in complex with NAD and an inhibitor (see paper)
54% identity, 97% coverage: 1:329/340 of query aligns to 3:329/335 of 4kqxB
- active site: K132 (= K131), D192 (= D191), E196 (= E195)
- binding n-hydroxy-n-isopropyloxamic acid: P134 (= P133), D192 (= D191), E196 (= E195), E232 (= E231), I252 (= I251), S253 (= S252), A256 (= A255)
- binding magnesium ion: G27 (= G25), Q29 (= Q27), G30 (= G28), A72 (= A71), E73 (≠ A72), A75 (≠ C74), L81 (≠ T80), N103 (≠ A102), D192 (= D191), E196 (= E195), N249 (≠ D248), S251 (= S250), I252 (= I251), I252 (= I251), S253 (= S252), N254 (= N253), E257 (= E256)
- binding nicotinamide-adenine-dinucleotide: Y26 (= Y24), G27 (= G25), S28 (= S26), Q29 (= Q27), R49 (= R48), L81 (≠ T80), V82 (≠ M81), P83 (= P82), D84 (= D83), V90 (≠ T89), H109 (= H108), P134 (= P133), S251 (= S250), I252 (= I251), S253 (= S252)
Sites not aligning to the query:
6jx2A Crystal structure of ketol-acid reductoisomerase from corynebacterium glutamicum (see paper)
56% identity, 96% coverage: 1:326/340 of query aligns to 1:324/325 of 6jx2A
- binding magnesium ion: N98 (≠ K99), D101 (≠ A102), D190 (= D191), E194 (= E195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G23), Y24 (= Y24), G25 (= G25), R47 (= R48), S50 (= S51), K51 (≠ A52), S52 (= S53), A80 (≠ M81), P81 (= P82), I88 (≠ T89)
6bulB Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 2
54% identity, 96% coverage: 3:329/340 of query aligns to 3:326/327 of 6bulB
- active site: K129 (= K131), D189 (= D191), E193 (= E195)
- binding {hydroxy[(1S)-1-phenylethyl]amino}(oxo)acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), E229 (= E231), I233 (= I235), I249 (= I251), S250 (= S252), A253 (= A255)
- binding oxo{[(1S)-1-phenylethyl]amino}acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), E229 (= E231), I233 (= I235), I249 (= I251), S250 (= S252), A253 (= A255)
- binding magnesium ion: D189 (= D191), E193 (= E195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y24), G25 (= G25), S26 (= S26), Q27 (= Q27), I46 (≠ L47), R47 (= R48), S51 (= S53), L78 (≠ T80), L79 (≠ M81), P80 (= P82), D81 (= D83), H106 (= H108), P131 (= P133), S248 (= S250), I249 (= I251), S250 (= S252)
6vo2A Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex with mg, NADPH and inhibitor. (see paper)
54% identity, 96% coverage: 3:329/340 of query aligns to 3:326/326 of 6vo2A
- binding magnesium ion: D189 (= D191), E193 (= E195)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y24), G25 (= G25), S26 (= S26), Q27 (= Q27), I46 (≠ L47), R47 (= R48), S51 (= S53), L78 (≠ T80), L79 (≠ M81), P80 (= P82), D81 (= D83), H106 (= H108), P131 (= P133), I249 (= I251), S250 (= S252)
- binding 3-(methylsulfonyl)-2-oxopropanoic acid: G130 (= G132), P131 (= P133), D189 (= D191), E193 (= E195), E229 (= E231), I249 (= I251), S250 (= S252), A253 (= A255)
6c5nA Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 1
54% identity, 96% coverage: 3:329/340 of query aligns to 3:326/326 of 6c5nA
- active site: K129 (= K131), D189 (= D191), E193 (= E195)
- binding (cyclopentylamino)(oxo)acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), C198 (= C200), E229 (= E231), I233 (= I235), I249 (= I251), S250 (= S252), A253 (= A255)
- binding [cyclopentyl(hydroxy)amino](oxo)acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), C198 (= C200), E229 (= E231), I249 (= I251), S250 (= S252), A253 (= A255)
- binding magnesium ion: D189 (= D191), E193 (= E195)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y24), G25 (= G25), S26 (= S26), Q27 (= Q27), I46 (≠ L47), R47 (= R48), S51 (= S53), L78 (≠ T80), L79 (≠ M81), P80 (= P82), D81 (= D83), H106 (= H108), P131 (= P133), S248 (= S250), I249 (= I251), S250 (= S252)
6c55A Crystal structure of staphylococcus aureus ketol-acid reductosimerrase with hydroxyoxamate inhibitor 3
54% identity, 96% coverage: 3:329/340 of query aligns to 3:326/326 of 6c55A
- active site: K129 (= K131), D189 (= D191), E193 (= E195)
- binding [cyclohexyl(hydroxy)amino](oxo)acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), C198 (= C200)
- binding (cyclohexylamino)(oxo)acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), C198 (= C200), I249 (= I251), S250 (= S252), A253 (= A255)
- binding magnesium ion: D189 (= D191), E193 (= E195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G25 (= G25), S26 (= S26), Q27 (= Q27), I46 (≠ L47), R47 (= R48), S51 (= S53), L79 (≠ M81), P80 (= P82), D81 (= D83), I83 (≠ L85), H106 (= H108), S248 (= S250), S250 (= S252)
6aqjA Crystal structures of staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity. (see paper)
54% identity, 96% coverage: 3:329/340 of query aligns to 3:326/326 of 6aqjA
- active site: K129 (= K131), D189 (= D191), E193 (= E195)
- binding oxo(propan-2-ylamino)acetic acid: P131 (= P133), D189 (= D191), E193 (= E195), E229 (= E231), I233 (= I235), I249 (= I251), S250 (= S252), A253 (= A255)
- binding n-hydroxy-n-isopropyloxamic acid: P131 (= P133), D189 (= D191), E193 (= E195), E229 (= E231), I249 (= I251), S250 (= S252), A253 (= A255)
- binding magnesium ion: D189 (= D191), E193 (= E195)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y24), G25 (= G25), S26 (= S26), Q27 (= Q27), I46 (≠ L47), R47 (= R48), S51 (= S53), L78 (≠ T80), L79 (≠ M81), P80 (= P82), D81 (= D83), H106 (= H108), P131 (= P133), I249 (= I251), S250 (= S252)
Query Sequence
>GFF644 FitnessBrowser__Phaeo:GFF644
MRVYYDRDCDVNLIKDKKVAILGYGSQGHAHALNLRDSGAKNLVVALREGSASAKKAEGE
GLQVMGIAEAAAWCDVIMFTMPDELQAETYKKYVHDNIKPGAAIAFAHGLNVHFGLIEPK
EGVDVIMMAPKGPGHTVRGEYTKGGGVPCLVAVDTDATGKALEIGLSYCSAIGGGRSGII
ETNFREECETDLFGEQAVLCGGIVELIRCGFETLVEAGYAPEMAYFECLHETKLIVDLIY
EGGIANMDYSISNTAEYGQYVTGPRILPYEQTKKAMKDVLTDIQQGKFVRDFMLENAVGQ
PTIKASRRANDEHQIEVVGGKLRDMMPWISAGKMVDKEKN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory