Comparing GFF655 FitnessBrowser__Phaeo:GFF655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
5t9fB Prephenate dehydrogenase n222d mutant from soybean (see paper)
25% identity, 84% coverage: 9:228/261 of query aligns to 4:230/253 of 5t9fB
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
31% identity, 77% coverage: 6:207/261 of query aligns to 3:219/293 of 4wjiA
Sites not aligning to the query:
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
28% identity, 64% coverage: 14:180/261 of query aligns to 17:170/280 of 2pv7B
Sites not aligning to the query:
>GFF655 FitnessBrowser__Phaeo:GFF655
MPQPPQFSRIGLIGFGAFGRLIARHLSPLLPICVYDPVQTDERPRHPSLRFDSLAETAAC
PLVILAVPVGAMEPLCHTLAPLVRPGTWVLDVGSVKMAPADVMQRVLPPEVNLLGTHPLF
GPESTRQGLAGQKIALCPLRGGRPLRLAAVLRHIFRLEVIWTTPEAHDRELATVQGLTHL
IAQALNQVAPETLRMTTASFELLQQASRMVTGDAHGVLEAILRDNPFAADIRDSFLERAA
DLGRHPVTPRTQQSPPNAAGF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory