SitesBLAST
Comparing GFF703 FitnessBrowser__Phaeo:GFF703 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
29% identity, 87% coverage: 4:282/321 of query aligns to 5:286/287 of 3pduA
- binding glycerol: R242 (≠ G238), E246 (≠ A242), E246 (≠ A242), R250 (= R246)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), G10 (= G9), I11 (≠ N10), M12 (≠ V11), N31 (≠ D30), R32 (≠ L31), N33 (= N32), M64 (≠ C63), L65 (= L64), A66 (≠ P65), A70 (= A69), T96 (= T92), V121 (= V117), G123 (= G119), T124 (≠ G120), K171 (= K167), S231 (= S227), F232 (= F228), P233 (≠ T229), H236 (≠ L232), K239 (= K235)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
30% identity, 82% coverage: 1:262/321 of query aligns to 14:275/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (≠ N10), M24 (≠ V11), N43 (≠ D30), R44 (≠ L31), T45 (≠ N32), K48 (≠ L35), M76 (≠ C63), V77 (≠ L64), S78 (≠ P65), D82 (≠ A69), Q85 (= Q72), V133 (= V117), F241 (= F228), K242 (≠ T229), H245 (≠ L232), K248 (= K235)
- binding sulfate ion: T134 (≠ S118), G135 (= G119), K183 (= K167)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
29% identity, 90% coverage: 2:289/321 of query aligns to 3:288/289 of 2cvzC
- active site: S117 (= S118), K165 (= K167), N168 (≠ T170), N169 (= N171)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), L9 (= L8), G10 (= G9), A11 (≠ N10), M12 (≠ V11), N30 (≠ Y29), R31 (≠ D30), T32 (≠ L31), C62 (= C63), L63 (= L64), P64 (= P65), E68 (≠ A69), E71 (≠ Q72), S91 (≠ T92), V116 (= V117), F227 (= F228), K234 (= K235)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
29% identity, 90% coverage: 2:289/321 of query aligns to 2:287/288 of 1wp4A
- active site: S116 (= S118), K164 (= K167), N167 (≠ T170), N168 (= N171)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G7), L8 (= L8), G9 (= G9), A10 (≠ N10), M11 (≠ V11), N29 (≠ Y29), R30 (≠ D30), T31 (≠ L31), K34 (≠ A34), C61 (= C63), L62 (= L64), P63 (= P65), E67 (≠ A69), S90 (≠ T92), V115 (= V117), T225 (≠ S227), F226 (= F228), K233 (= K235)
- binding sulfate ion: S116 (= S118), G117 (= G119), G118 (= G120), K164 (= K167)
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
28% identity, 85% coverage: 2:274/321 of query aligns to 3:279/287 of 3pefA
- binding glycerol: D67 (≠ S66), G123 (= G119), K171 (= K167), N175 (= N171), M178 (≠ A174), L203 (≠ Y199), G207 (≠ K203), N213 (≠ S209), A217 (≠ E213), F232 (= F228), H236 (≠ L232), K239 (= K235), R242 (≠ G238), R269 (≠ E265)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G9), I11 (≠ N10), M12 (≠ V11), N31 (≠ D30), R32 (≠ L31), S33 (≠ N32), K36 (≠ L35), M64 (≠ C63), L65 (= L64), A66 (≠ P65), A70 (= A69), E73 (≠ Q72), T96 (= T92), V121 (= V117), G123 (= G119), S124 (≠ G120), A231 (≠ S227), F232 (= F228), H236 (≠ L232), K239 (= K235)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
29% identity, 82% coverage: 1:262/321 of query aligns to 14:278/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (≠ N10), M24 (≠ V11), N43 (≠ D30), R44 (≠ L31), T45 (≠ N32), K48 (≠ L35), V77 (≠ L64), S78 (≠ P65), D82 (≠ A69), Q85 (= Q72), V133 (= V117), F244 (= F228), K245 (≠ T229), H248 (≠ L232), K251 (= K235)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
28% identity, 88% coverage: 3:283/321 of query aligns to 41:331/335 of P29266
- D68 (= D30) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K167) mutation K->A,H,N,R: Complete loss of activity.
- N212 (= N171) mutation to Q: Decrease in activity.
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
27% identity, 88% coverage: 1:283/321 of query aligns to 1:293/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), N10 (= N10), M11 (≠ V11), Y29 (= Y29), D30 (= D30), V31 (≠ L31), M63 (≠ C63), L64 (= L64), P65 (= P65), T95 (= T92), V120 (= V117), G122 (= G119), F238 (= F228), K245 (= K235)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
27% identity, 81% coverage: 3:262/321 of query aligns to 42:311/336 of P31937
- LP 103:104 (= LP 64:65) binding
- N108 (≠ A69) binding
- T134 (= T92) binding
- K284 (= K235) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
28% identity, 81% coverage: 2:262/321 of query aligns to 269:532/553 of Q49A26
- 271:285 (vs. 4:18, 40% identical) binding
- T362 (= T92) binding
- M437 (≠ K167) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (≠ I226) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K235) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
28% identity, 81% coverage: 2:262/321 of query aligns to 268:525/546 of Q922P9
- P489 (≠ I226) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
2uyyA Structure of the cytokine-like nuclear factor n-pac
28% identity, 81% coverage: 2:262/321 of query aligns to 8:271/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G9), L16 (≠ N10), M17 (≠ V11), N36 (≠ D30), R37 (≠ L31), T38 (≠ N32), V70 (≠ L64), S71 (≠ P65), A75 (= A68), T101 (= T92), F237 (= F228), Y238 (≠ T229), Y241 (≠ L232), K244 (= K235)
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
28% identity, 89% coverage: 3:287/321 of query aligns to 3:291/294 of 6smyA
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
28% identity, 89% coverage: 3:287/321 of query aligns to 4:292/298 of P0A9V8
- QM 11:12 (≠ NV 10:11) binding
- D31 (= D30) binding
- L65 (= L64) binding
- T96 (= T92) binding
- G122 (≠ S118) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G119) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G120) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ TNYLA 170:174) binding
- K240 (= K235) binding
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
28% identity, 89% coverage: 3:287/321 of query aligns to 3:291/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), Q10 (≠ N10), M11 (≠ V11), F29 (≠ Y29), D30 (= D30), V31 (≠ L31), M63 (≠ C63), L64 (= L64), V73 (≠ Q76), S94 (= S91), T95 (= T92), R122 (≠ G119)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
27% identity, 83% coverage: 2:266/321 of query aligns to 5:274/294 of 5je8B
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
32% identity, 74% coverage: 2:239/321 of query aligns to 2:248/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), H10 (≠ N10), M11 (≠ V11), F29 (≠ Y29), D30 (= D30), L31 (= L31), M63 (≠ C63), L64 (= L64), P65 (= P65), T94 (= T92), V119 (= V117), G121 (= G119), F237 (= F228), K244 (= K235)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
32% identity, 74% coverage: 2:239/321 of query aligns to 3:250/298 of Q9I5I6
- P66 (= P65) binding
- T96 (= T92) binding ; mutation to A: Almost abolished activity.
- S122 (= S118) mutation to A: Strongly reduced activity.
- K171 (= K167) active site
- N175 (= N171) mutation to A: Strongly reduced activity.
- W214 (≠ F210) mutation to A: Almost abolished activity.
- Y219 (≠ H212) mutation to A: Strongly reduced activity.
- K246 (= K235) binding ; mutation to A: Almost abolished activity.
- D247 (= D236) mutation to A: Almost abolished activity.
Sites not aligning to the query:
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
31% identity, 74% coverage: 2:239/321 of query aligns to 3:249/295 of 3obbA
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
26% identity, 74% coverage: 3:239/321 of query aligns to 3:246/292 of 5y8iA
Query Sequence
>GFF703 FitnessBrowser__Phaeo:GFF703
MKVGFIGLGNVGGKLSGSLLRNGIDLSVYDLNEALVAKAAEVGATAANDPAELMRNCDAV
ITCLPSPAASDQVMQQMLPEIGPGKIWMEMSTTDEAEVKRLGAMVEQAGGTAVDCPVSGG
CHRADTGNISIFAGCDRETFDRIAPLLKTMGRRILHTGPIGSASVLKVITNYLATANLLT
CCEALVTAKAAGMDLNTAYEAIKISSGTSFVHETESQVILNGSRDISFTMDLVSKDIGLF
QAVADRHNVPLEINPLMIKIFKDGEERFGSRELSPNIIRRLEEATGLEITAPGFPPEMTD
DEPEEPGYEVIPTGRDGSPAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory