SitesBLAST
Comparing GFF706 FitnessBrowser__Phaeo:GFF706 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
30% identity, 98% coverage: 2:321/328 of query aligns to 3:331/340 of 4n54A
- active site: K96 (= K92), H183 (= H173)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R11), K96 (= K92), D156 (= D151), D179 (= D169), M180 (= M170), H183 (= H173), R238 (= R228), Y244 (= Y234)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ L7), G9 (= G8), L10 (≠ C9), G11 (= G10), R12 (= R11), L13 (≠ I12), S35 (≠ D33), V36 (≠ A34), E40 (≠ A38), S73 (≠ T69), P74 (= P70), F77 (≠ T73), H78 (= H74), E95 (= E91), K96 (= K92), M125 (≠ N120), F167 (vs. gap), F284 (= F274)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
29% identity, 100% coverage: 2:328/328 of query aligns to 5:340/342 of 3ceaA
- active site: K98 (= K92), H185 (= H173)
- binding nicotinamide-adenine-dinucleotide: G11 (= G8), G13 (= G10), R14 (= R11), L15 (≠ I12), L38 (≠ A34), Q42 (≠ A38), V74 (≠ G68), A75 (≠ T69), P76 (= P70), T77 (= T71), F79 (≠ T73), H80 (= H74), M83 (≠ L77), E97 (= E91), K98 (= K92), M127 (≠ N120), F169 (vs. gap), H185 (= H173), F286 (= F274)
8qc8D Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
27% identity, 100% coverage: 2:328/328 of query aligns to 2:338/339 of 8qc8D
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), H11 (≠ R11), M12 (≠ I12), D33 (= D33), P34 (≠ A34), T35 (≠ M35), S38 (≠ A38), A71 (≠ G68), S72 (≠ T69), P73 (= P70), N74 (≠ T71), H77 (= H74), E96 (= E91), K97 (= K92), E125 (≠ N120), K162 (≠ P156), V163 (≠ I157), W166 (vs. gap)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
29% identity, 98% coverage: 2:323/328 of query aligns to 3:321/336 of 3ec7A
- active site: K97 (= K92), H176 (= H173)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), M12 (≠ R11), I13 (= I12), D35 (= D33), I36 (≠ A34), R40 (≠ A38), T73 (≠ G68), A74 (≠ T69), S75 (≠ P70), N76 (≠ T71), H79 (= H74), E96 (= E91), K97 (= K92), M126 (≠ N120), W271 (≠ F274), Y279 (= Y282)
8qc8B Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
30% identity, 59% coverage: 2:193/328 of query aligns to 6:207/367 of 8qc8B
- binding nicotinamide-adenine-dinucleotide: H15 (≠ R11), M16 (≠ I12), D37 (= D33), P38 (≠ A34), T39 (≠ M35), S42 (≠ A38), A75 (≠ G68), S76 (≠ T69), P77 (= P70), N78 (≠ T71), H81 (= H74), E100 (= E91), K101 (= K92), E129 (≠ N120), K166 (≠ P156), V167 (≠ I157), W170 (vs. gap)
Sites not aligning to the query:
8qc2A Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ and sulfoquinovose (sq) (see paper)
30% identity, 59% coverage: 2:193/328 of query aligns to 4:205/363 of 8qc2A
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), H13 (≠ R11), M14 (≠ I12), D35 (= D33), P36 (≠ A34), T37 (≠ M35), S40 (≠ A38), A73 (≠ G68), S74 (≠ T69), P75 (= P70), N76 (≠ T71), H79 (= H74), E98 (= E91), K99 (= K92), E127 (≠ N120), K164 (≠ P156), V165 (≠ I157), W168 (vs. gap)
- binding sulfoquinovose: K99 (= K92), Y128 (≠ R121), R158 (= R150), F161 (≠ S153), L162 (≠ P154), K164 (≠ P156), E181 (≠ D169), H185 (= H173)
Sites not aligning to the query:
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
26% identity, 98% coverage: 2:323/328 of query aligns to 3:322/337 of 3nt5A
- active site: K97 (= K92), H176 (= H173)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K92), H155 (≠ S149), H176 (= H173), Y235 (= Y234)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), G11 (= G10), A12 (≠ R11), I13 (= I12), D35 (= D33), V36 (≠ A34), S74 (≠ T69), W75 (≠ P70), G76 (≠ T71), E96 (= E91), K97 (= K92), Y280 (= Y282)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
26% identity, 98% coverage: 2:323/328 of query aligns to 3:322/337 of 3nt4A
- active site: K97 (= K92), H176 (= H173)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ S149), H176 (= H173), Y235 (= Y234), W272 (≠ F274)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G10), A12 (≠ R11), I13 (= I12), D35 (= D33), V36 (≠ A34), S74 (≠ T69), W75 (≠ P70), G76 (≠ T71), E96 (= E91), K97 (= K92), H176 (= H173)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
26% identity, 98% coverage: 2:323/328 of query aligns to 3:322/337 of 3nt2B
- active site: K97 (= K92), H176 (= H173)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G8), G11 (= G10), A12 (≠ R11), D35 (= D33), V36 (≠ A34), S74 (≠ T69), W75 (≠ P70), A78 (≠ T73), K97 (= K92), W272 (≠ F274), Y280 (= Y282)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
26% identity, 98% coverage: 2:323/328 of query aligns to 3:322/337 of 3nt2A
- active site: K97 (= K92), H176 (= H173)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), G11 (= G10), A12 (≠ R11), I13 (= I12), D35 (= D33), V36 (≠ A34), S74 (≠ T69), W75 (≠ P70), G76 (≠ T71), A78 (≠ T73), H79 (= H74), E96 (= E91), K97 (= K92), H176 (= H173), Y280 (= Y282)
6o15A Crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with NAD(h) (see paper)
28% identity, 76% coverage: 1:248/328 of query aligns to 1:250/355 of 6o15A
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), Y11 (≠ R11), F12 (≠ I12), Y32 (≠ A32), D33 (= D33), A67 (≠ G68), T68 (= T69), P69 (= P70), N70 (≠ T71), H73 (= H74), E90 (= E91), K91 (= K92), I119 (≠ N120), W160 (≠ Y159)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
26% identity, 98% coverage: 2:323/328 of query aligns to 3:322/337 of 4l8vA
- active site: K97 (= K92), H176 (= H173)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R11), I13 (= I12), S74 (≠ T69), W75 (≠ P70), H79 (= H74), E96 (= E91), K97 (= K92), M126 (≠ N120), W272 (≠ F274), Y280 (= Y282)
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
26% identity, 100% coverage: 1:328/328 of query aligns to 1:329/333 of 4koaA
- active site: K94 (= K92), H180 (= H173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), A9 (≠ C9), S10 (≠ G10), T11 (≠ R11), I12 (= I12), S33 (≠ D33), S34 (≠ A34), R38 (≠ A38), T71 (= T69), N73 (≠ T71), H76 (= H74), K94 (= K92), Q160 (≠ S158)
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
27% identity, 93% coverage: 1:306/328 of query aligns to 2:307/339 of 4mjlD
- active site: K97 (= K92)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K92), H155 (≠ S149), N157 (≠ D151), D172 (= D169), T173 (≠ M170), H176 (= H173), Y236 (= Y234)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), A12 (≠ R11), M13 (≠ I12), D35 (= D33), I36 (≠ A34), V73 (≠ G68), S74 (≠ T69), H79 (= H74), E96 (= E91), K97 (= K92), M126 (≠ N120), D172 (= D169), W274 (≠ F274), Y282 (= Y282)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
27% identity, 93% coverage: 1:306/328 of query aligns to 2:307/339 of 4mioD
- active site: K97 (= K92)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K92), H155 (≠ S149), N157 (≠ D151), D172 (= D169), T173 (≠ M170), H176 (= H173), Y236 (= Y234)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ R11), M13 (≠ I12), D35 (= D33), I36 (≠ A34), S74 (≠ T69), A78 (≠ T73), H79 (= H74), E96 (= E91), K97 (= K92), M126 (≠ N120), D172 (= D169), W274 (≠ F274), Y282 (= Y282)
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
27% identity, 93% coverage: 1:306/328 of query aligns to 2:307/339 of 4mioA
- active site: K97 (= K92)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G10), A12 (≠ R11), M13 (≠ I12), D35 (= D33), I36 (≠ A34), S74 (≠ T69), F75 (≠ P70), H79 (= H74), E96 (= E91), K97 (= K92), W274 (≠ F274), Y282 (= Y282)
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
27% identity, 93% coverage: 1:306/328 of query aligns to 2:307/339 of 4minA
- active site: K97 (= K92)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), A12 (≠ R11), M13 (≠ I12), D35 (= D33), I36 (≠ A34), V73 (≠ G68), S74 (≠ T69), F75 (≠ P70), H79 (= H74), E96 (= E91), K97 (= K92), Y282 (= Y282)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
26% identity, 87% coverage: 38:323/328 of query aligns to 39:323/332 of 2glxA
- active site: K93 (= K92), H179 (= H173)
- binding acetate ion: K93 (= K92), H179 (= H173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S69 (≠ G68), T70 (= T69), N72 (≠ T71), H75 (= H74), E92 (= E91), K93 (= K92), H121 (≠ N120), W161 (≠ I160), R162 (≠ K161), Y282 (= Y282)
Sites not aligning to the query:
8qc6A Crystal structure of NAD-dependent glycoside hydrolase from arthrobacter sp. U41 in complex with NAD+ and sulfoquinovose (sq) (see paper)
27% identity, 67% coverage: 2:220/328 of query aligns to 6:239/366 of 8qc6A
- binding nicotinamide-adenine-dinucleotide: H15 (≠ R11), M16 (≠ I12), D37 (= D33), P38 (≠ A34), S42 (≠ A38), A75 (≠ G68), S76 (≠ T69), P77 (= P70), N78 (≠ T71), H81 (= H74), E100 (= E91), K101 (= K92), E129 (≠ N120), K166 (≠ P156), V167 (≠ I157), W170 (vs. gap)
- binding sulfoquinovose: K101 (= K92), Y130 (≠ R121), R160 (= R150), F163 (≠ S153), L164 (≠ P154), K166 (≠ P156), E183 (≠ D169), K184 (≠ M170), H187 (= H173)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
26% identity, 87% coverage: 38:323/328 of query aligns to 40:324/333 of Q2I8V6
- TTNELH 71:76 (≠ TPTDTH 69:74) binding
- EK 93:94 (= EK 91:92) binding
- K94 (= K92) mutation to G: Less than 1% remaining activity.
- N120 (≠ A118) binding
- WR 162:163 (≠ IK 160:161) binding
- D176 (= D169) mutation to A: Less than 1% remaining activity.
- H180 (= H173) mutation to A: Less than 2% remaining activity.
- G206 (= G202) mutation to I: No effect.
- Y283 (= Y282) binding
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 33 S→D: No activity.
- 33:34 binding
- 38 binding
Query Sequence
>GFF706 FitnessBrowser__Phaeo:GFF706
MLNIGLLGCGRIGQVHARSVGQLDGVRVTAVADAMPDAANALASKIGADVREASALITSA
DVDAVVIGTPTDTHYDLIHQAAAAGKAIFCEKPVDMSADRIRDCQKVVTEAGVAFLTAFN
RRFDPNFANLQQRLRAGEIGDVEIVSILSRDPSPPPISYIKTSGGLFRDMMIHDFDMARF
LLAEEPVQVFAVGSALVDPAIGAAGDVDTAAVTLTTTSGKICQISNSRRATYGYDQRVEV
HGSKGMLRAANMLENTVEVAGTTGFQTAPAQHFFLERYEAAYRNEMARFVEAVQTGNTPS
PSIDDGLRAQMLADAAAQSLETGAPVAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory