Comparing GFF709 FitnessBrowser__Phaeo:GFF709 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
30% identity, 85% coverage: 41:321/330 of query aligns to 28:301/309 of Q53W83
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
29% identity, 95% coverage: 8:321/330 of query aligns to 1:309/310 of 5yggA
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
28% identity, 86% coverage: 39:321/330 of query aligns to 20:305/306 of 5eynA
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
30% identity, 85% coverage: 41:321/330 of query aligns to 28:301/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
31% identity, 84% coverage: 41:317/330 of query aligns to 28:300/300 of 1v1bA
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
25% identity, 84% coverage: 45:321/330 of query aligns to 31:305/308 of 2dcnA
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
25% identity, 80% coverage: 19:281/330 of query aligns to 6:256/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
25% identity, 80% coverage: 19:281/330 of query aligns to 5:255/302 of 3gbuA
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
23% identity, 93% coverage: 18:324/330 of query aligns to 9:310/319 of Q8ZKR2
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
25% identity, 84% coverage: 45:321/330 of query aligns to 32:308/313 of Q97U29
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
25% identity, 84% coverage: 45:321/330 of query aligns to 31:307/311 of 2varA
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
23% identity, 93% coverage: 18:324/330 of query aligns to 5:299/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
23% identity, 92% coverage: 18:322/330 of query aligns to 5:297/297 of 1tz6A
8cqxA Ribokinase from t.Sp mutant a92g
24% identity, 93% coverage: 16:321/330 of query aligns to 2:298/300 of 8cqxA
6znxC Ribokinase from thermus species
24% identity, 93% coverage: 16:321/330 of query aligns to 2:263/265 of 6znxC
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
24% identity, 84% coverage: 47:324/330 of query aligns to 36:308/308 of 3iq0B
7fcaD Pfkb(mycobacterium marinum) (see paper)
28% identity, 81% coverage: 17:283/330 of query aligns to 5:242/282 of 7fcaD
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 88% coverage: 30:321/330 of query aligns to 89:375/379 of A1A6H3
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
27% identity, 88% coverage: 30:321/330 of query aligns to 23:309/313 of 6ilsB
Sites not aligning to the query:
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
26% identity, 93% coverage: 16:321/330 of query aligns to 7:305/309 of P0A9J6
>GFF709 FitnessBrowser__Phaeo:GFF709
MGQPSKARSDLAGRNFLVIGRVGMDLCPTPAGTATADAQDMMVAMGGSSANIAAGLVKMG
CRSALVTSVSDDAVGWYCLNQLDHYGVDRTHVKRITGEYRTSLAVYESRVEDHQSVIYRN
NAADFQMTIADVEAVDYSQYSALITAGTVFAAEPSRSATFRAFDLARAAGLPIIFDVDYR
PYSWPSPEVAADVLSRAGAMSDIIVGNDEEFGFMAGGIDKGRAKARALAETSASVVVYKM
GPKGAVTFADGQEIRTGIYPVDALKPTGAGDSFMAGFLASLSEGRPMKDAILRGSACASV
VVAKPGCAPAMPDLAALEAFLATHPGATEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory