SitesBLAST
Comparing GFF710 FitnessBrowser__Phaeo:GFF710 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
25% identity, 81% coverage: 9:514/624 of query aligns to 5:466/539 of 6lpiB
- active site: I27 (= I41), G29 (= G43), G30 (= G45), S31 (≠ N46), I32 (≠ V47), E53 (= E69), C76 (≠ S94), F115 (≠ L133), Q116 (= Q134), E117 (≠ Q135), K165 (≠ Q192), M256 (≠ V287), A283 (≠ T314), V375 (≠ G420), G401 (≠ S445), M403 (= M447), D428 (= D476), N455 (= N503), A457 (≠ G505), L458 (≠ F506), L460 (≠ V508), V461 (≠ I509), Q464 (≠ L512)
- binding flavin-adenine dinucleotide: R155 (≠ D182), G212 (= G241), G213 (= G242), G214 (= G243), T236 (= T267), L237 (≠ I268), M238 (≠ A269), L254 (≠ I285), M256 (≠ V287), H257 (≠ T288), G276 (= G307), A277 (≠ T308), R278 (= R309), D280 (≠ Q311), R282 (≠ F313), A283 (≠ T314), D300 (≠ N331), I301 (≠ A332), D319 (= D348), V320 (≠ A349), M380 (≠ E425), G398 (≠ F442)
- binding magnesium ion: D428 (= D476), N455 (= N503)
- binding thiamine diphosphate: E53 (= E69), C76 (≠ S94), P79 (= P97), G376 (= G421), Q377 (≠ L422), H378 (≠ P423), G401 (≠ S445), M403 (= M447), G427 (= G475), D428 (= D476), G429 (= G477), S430 (= S478), M433 (= M481), N455 (= N503), A457 (≠ G505), L458 (≠ F506), G459 (≠ A507), L460 (≠ V508), V461 (≠ I509)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
24% identity, 75% coverage: 58:526/624 of query aligns to 131:597/664 of P09114
- P191 (≠ L133) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (vs. gap) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
24% identity, 75% coverage: 58:526/624 of query aligns to 134:600/667 of P09342
- C161 (= C91) modified: Disulfide link with 307
- P194 (≠ L133) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V244) modified: Disulfide link with 161
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
23% identity, 87% coverage: 41:580/624 of query aligns to 25:541/582 of 1t9dB
- active site: Y28 (≠ H44), G30 (vs. gap), G31 (= G45), A32 (≠ N46), I33 (≠ V47), E54 (= E69), T77 (= T92), F116 (= F150), Q117 (≠ K151), E118 (≠ P152), K166 (≠ Q192), R213 (≠ A251), M249 (≠ V287), V276 (≠ T314), V392 (≠ L422), L417 (≠ F444), G418 (≠ S445), M420 (= M447), D445 (= D476), N472 (= N503), E474 (≠ G505), Q475 (≠ F506), M477 (≠ V508), V478 (≠ I509), W481 (≠ L512), L503 (≠ H542), G508 (= G547), L509 (≠ A548)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (= G45), A32 (≠ N46), V106 (≠ T123), P107 (= P142), F116 (= F150), K166 (≠ Q192), M249 (≠ V287), D274 (= D312), R275 (≠ F313), W481 (≠ L512)
- binding flavin-adenine dinucleotide: R156 (≠ D182), G202 (= G241), A203 (≠ G242), G204 (= G243), N207 (≠ Q245), T229 (= T267), L230 (≠ I268), Q231 (≠ A269), L247 (≠ I285), M249 (≠ V287), H250 (≠ T288), G269 (= G307), A270 (≠ T308), R271 (= R309), D273 (≠ Q311), R275 (≠ F313), V276 (≠ T314), E302 (≠ N331), V303 (≠ A332), N307 (≠ D336), G320 (= G347), D321 (= D348), A322 (= A349), Q396 (vs. gap), M397 (vs. gap), G415 (≠ F442), G416 (= G443)
- binding magnesium ion: D445 (= D476), N472 (= N503), E474 (≠ G505)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E69), P80 (= P97), G418 (≠ S445), M420 (= M447), M450 (= M481)
Sites not aligning to the query:
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
23% identity, 87% coverage: 41:580/624 of query aligns to 26:542/583 of 1t9bA
- active site: Y29 (≠ H44), G31 (vs. gap), G32 (= G45), A33 (≠ N46), I34 (≠ V47), E55 (= E69), T78 (= T92), F117 (= F150), Q118 (≠ K151), E119 (≠ P152), K167 (≠ Q192), R214 (≠ A251), M250 (≠ V287), V277 (≠ T314), V393 (≠ L422), L418 (≠ F444), G419 (≠ S445), M421 (= M447), D446 (= D476), N473 (= N503), E475 (≠ G505), Q476 (≠ F506), M478 (≠ V508), V479 (≠ I509), W482 (≠ L512), L504 (≠ H542), G509 (= G547), L510 (≠ A548)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (≠ T123), P108 (= P142), F117 (= F150), D275 (= D312), R276 (≠ F313), M478 (≠ V508), W482 (≠ L512)
- binding flavin-adenine dinucleotide: R157 (≠ D182), G203 (= G241), A204 (≠ G242), G205 (= G243), N208 (≠ Q245), T230 (= T267), L231 (≠ I268), Q232 (≠ A269), M247 (≠ P284), L248 (≠ I285), M250 (≠ V287), H251 (≠ T288), G270 (= G307), A271 (≠ T308), R272 (= R309), D274 (≠ Q311), R276 (≠ F313), V277 (≠ T314), E303 (≠ N331), V304 (≠ A332), N308 (≠ D336), D322 (= D348), A323 (= A349), Q397 (vs. gap), M398 (vs. gap), G416 (≠ F442), G417 (= G443)
- binding magnesium ion: D446 (= D476), N473 (= N503), E475 (≠ G505)
Sites not aligning to the query:
7egvA Acetolactate synthase from trichoderma harzianum with inhibitor harzianic acid (see paper)
24% identity, 86% coverage: 30:564/624 of query aligns to 14:533/590 of 7egvA
- active site: Y28 (≠ H44), G30 (vs. gap), G31 (= G45), A32 (≠ N46), I33 (≠ V47), E54 (= E69), T77 (= T92), F116 (= F150), Q117 (≠ K151), K166 (≠ Q192), E220 (= E252), M256 (≠ V287), V283 (≠ T314), V400 (≠ A419), L425 (≠ F444), G426 (≠ S445), M428 (= M447), Q483 (≠ F506), M485 (≠ V508), V486 (≠ I509), W489 (≠ L512), L511 (≠ H542), G516 (= G547), I517 (≠ A548)
- binding flavin-adenine dinucleotide: R156 (≠ D182), G209 (= G241), Q210 (≠ G242), G211 (= G243), T236 (= T267), L237 (≠ I268), H238 (≠ A269), G276 (= G307), S277 (≠ T308), R278 (= R309), D280 (≠ Q311), R282 (≠ F313), V283 (≠ T314), E309 (≠ A337), I310 (≠ G338), D328 (= D355), V329 (≠ L356), M405 (≠ A424), G423 (≠ F442), G424 (= G443)
- binding (2S)-3-methyl-2-[[(2S,4R)-1-methyl-4-[(2E,4E)-octa-2,4-dienoyl]-3,5-bis(oxidanylidene)pyrrolidin-2-yl]methyl]-2-oxidanyl-butanoic acid: F493 (≠ T516), Y494 (≠ G517)
- binding magnesium ion: D453 (= D476), N480 (= N503), E482 (≠ G505)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: P29 (vs. gap), E54 (= E69), Q117 (≠ K151), V400 (≠ A419), G401 (= G420), Q402 (≠ G421), H403 (≠ L422), G426 (≠ S445), M428 (= M447), D453 (= D476), A454 (≠ G477), S455 (= S478), E482 (≠ G505), Q483 (≠ F506), G484 (≠ A507), M485 (≠ V508), V486 (≠ I509)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
23% identity, 81% coverage: 58:564/624 of query aligns to 52:541/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ V287), R292 (≠ F313), W489 (≠ L512)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ A419), G401 (= G420), Q402 (≠ G421), H403 (≠ L422), G426 (≠ S445), M428 (= M447), G452 (= G475), D453 (= D476), G454 (= G477), S455 (= S478), L483 (≠ F506), G484 (≠ A507), M485 (≠ V508), V486 (≠ I509)
- binding flavin-adenine dinucleotide: R161 (≠ D182), G222 (= G241), G223 (= G242), G224 (= G243), T246 (= T267), L247 (≠ I268), M248 (≠ A269), M263 (≠ P284), L264 (≠ I285), M266 (≠ V287), H267 (≠ T288), G286 (= G307), R288 (= R309), V293 (≠ T314), D310 (≠ N331), I311 (≠ A332), D329 (= D348), V330 (≠ A349), M405 (≠ A424), G423 (≠ F442)
- binding magnesium ion: T82 (≠ S94), S83 (≠ A95), Q122 (≠ K151), Y381 (= Y398), D453 (= D476), M458 (= M481), Q461 (≠ S484), N480 (= N503), H482 (≠ G505), K533 (≠ P556)
Sites not aligning to the query:
8beoB Crystal structure of e. Coli glyoxylate carboligase mutant i393a with map
24% identity, 77% coverage: 91:568/624 of query aligns to 71:539/592 of 8beoB
- binding methyl hydrogen (s)-acetylphosphonate: C490 (≠ T516), Q492 (≠ N518)
- binding flavin-adenine dinucleotide: R153 (≠ D182), P154 (≠ C183), G210 (= G241), G211 (= G242), G212 (= G243), N215 (≠ Y246), T236 (= T267), L237 (≠ I268), M238 (≠ A269), V254 (≠ I285), G255 (= G286), Q257 (vs. gap), T258 (= T288), G277 (= G307), N278 (≠ T308), R279 (= R309), A281 (≠ Q311), R283 (≠ F313), H284 (≠ T314), D301 (≠ N331), I302 (≠ A332), Q306 (≠ D336), D320 (= D348), A321 (= A349), G415 (= G443)
- binding magnesium ion: D445 (= D476), F450 (≠ M481), L451 (= L482), E453 (≠ S484), N472 (= N503), Y474 (≠ G505)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1s)-1-hydroxy-1-[(r)-hydroxy(methoxy)phosphoryl]ethyl}-5-(2-{[(s)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: R283 (≠ F313), G393 (= G421), L394 (= L422), S395 (≠ P423), L420 (≠ M447), G444 (= G475), D445 (= D476), F446 (≠ G477), D447 (≠ S478), N472 (= N503), Y474 (≠ G505), L475 (≠ F506), G476 (≠ A507), L477 (≠ V508), I478 (= I509)
- binding 2,3-dimethoxy-5-methyl-1,4-benzoquinone: Q352 (= Q374), R356 (≠ H378)
Sites not aligning to the query:
8beoA Crystal structure of e. Coli glyoxylate carboligase mutant i393a with map
24% identity, 77% coverage: 91:568/624 of query aligns to 71:539/592 of 8beoA
- binding flavin-adenine dinucleotide: R153 (≠ D182), P154 (≠ C183), G210 (= G241), G211 (= G242), G212 (= G243), N215 (≠ Y246), T236 (= T267), L237 (≠ I268), M238 (≠ A269), V254 (≠ I285), G255 (= G286), Q257 (vs. gap), T258 (= T288), G277 (= G307), N278 (≠ T308), R279 (= R309), A281 (≠ Q311), R283 (≠ F313), H284 (≠ T314), D301 (≠ N331), I302 (≠ A332), Q306 (≠ D336), D320 (= D348), A321 (= A349), I397 (≠ E425), G415 (= G443)
- binding magnesium ion: R384 (≠ K412), V405 (≠ L433), F406 (≠ E434), H410 (≠ V438), D445 (= D476), F450 (≠ M481), L451 (= L482), E453 (≠ S484), N472 (= N503), Y474 (≠ G505)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1s)-1-hydroxy-1-[(r)-hydroxy(methoxy)phosphoryl]ethyl}-5-(2-{[(s)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: R283 (≠ F313), G393 (= G421), L394 (= L422), S395 (≠ P423), L420 (≠ M447), G444 (= G475), D445 (= D476), F446 (≠ G477), D447 (≠ S478), N472 (= N503), Y474 (≠ G505), L475 (≠ F506), G476 (≠ A507), L477 (≠ V508), I478 (= I509)
- binding 2,3-dimethoxy-5-methyl-1,4-benzoquinone: E248 (≠ P279), Q352 (= Q374)
Sites not aligning to the query:
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
22% identity, 81% coverage: 58:564/624 of query aligns to 52:541/585 of 5k2oA
- active site: E59 (= E69), T82 (≠ S94), F121 (= F150), Q122 (≠ K151), E123 (≠ P152), K171 (≠ Q192), M266 (≠ V287), V293 (≠ T314), V400 (≠ A419), G426 (≠ S445), M428 (= M447), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ F506), M485 (≠ V508), V486 (≠ I509), W489 (≠ L512)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ V287), R292 (≠ F313), W489 (≠ L512)
- binding flavin-adenine dinucleotide: R161 (≠ D182), G222 (= G241), G223 (= G242), G224 (= G243), T246 (= T267), L247 (≠ I268), M248 (≠ A269), L264 (≠ I285), G286 (= G307), R288 (= R309), D290 (≠ Q311), V293 (≠ T314), D310 (≠ N331), I311 (≠ A332), D329 (= D348), V330 (≠ A349), Q404 (≠ P423), M405 (≠ A424), G423 (≠ F442)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ A419), G401 (= G420), Q402 (≠ G421), H403 (≠ L422), M428 (= M447), D453 (= D476), G454 (= G477), S455 (= S478), N480 (= N503), H482 (≠ G505), L483 (≠ F506), G484 (≠ A507), M485 (≠ V508), V486 (≠ I509)
Sites not aligning to the query:
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
22% identity, 81% coverage: 58:564/624 of query aligns to 137:626/670 of P17597
- E144 (= E69) binding
- S186 (≠ R113) binding
- P197 (= P129) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ P131) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (≠ K151) binding
- K220 (≠ R159) binding
- R246 (≠ D182) binding ; binding
- K256 (≠ Q192) binding
- G308 (= G242) binding
- TL 331:332 (≠ TI 267:268) binding
- C340 (≠ D276) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ IGVT 285:288) binding
- GVRFD 371:375 (≠ GTRLQ 307:311) binding
- DR 376:377 (≠ DF 312:313) binding
- DI 395:396 (≠ NA 331:332) binding
- DV 414:415 (≠ DA 348:349) binding
- QH 487:488 (≠ GL 421:422) binding
- GG 508:509 (≠ FG 442:443) binding
- GAM 511:513 (≠ SCM 445:447) binding
- D538 (= D476) binding
- DGS 538:540 (= DGS 476:478) binding
- N565 (= N503) binding
- NQHLGM 565:570 (≠ NGGFAV 503:508) binding
- H567 (≠ G505) binding
- W574 (≠ L512) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
Sites not aligning to the query:
- 122 A→V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- 124 M→E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; M→I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- 653 binding ; S→A: No effect on catalytic activity or sensitivity to herbicides.; S→F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; S→N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; S→T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
22% identity, 81% coverage: 58:564/624 of query aligns to 52:541/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ A419), G401 (= G420), Q402 (≠ G421), H403 (≠ L422), G426 (≠ S445), M428 (= M447), G452 (= G475), D453 (= D476), G454 (= G477), S455 (= S478), M458 (= M481), N480 (= N503), H482 (≠ G505), L483 (≠ F506), G484 (≠ A507), M485 (≠ V508), V486 (≠ I509)
- binding flavin-adenine dinucleotide: R161 (≠ D182), G222 (= G241), G223 (= G242), G224 (= G243), T246 (= T267), L247 (≠ I268), M248 (≠ A269), L264 (≠ I285), M266 (≠ V287), H267 (≠ T288), G286 (= G307), V287 (≠ T308), R288 (= R309), D290 (≠ Q311), R292 (≠ F313), V293 (≠ T314), D310 (≠ N331), I311 (≠ A332), D329 (= D348), V330 (≠ A349), M405 (≠ A424), G423 (≠ F442)
- binding magnesium ion: F370 (≠ N387), D453 (= D476), M458 (= M481), Q461 (≠ S484), N480 (= N503), H482 (≠ G505), K533 (≠ P556)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ V287), R292 (≠ F313), M485 (≠ V508), W489 (≠ L512)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
22% identity, 81% coverage: 58:564/624 of query aligns to 52:541/582 of 5wj1A
- active site: E59 (= E69), T82 (≠ S94), F121 (= F150), Q122 (≠ K151), E123 (≠ P152), K171 (≠ Q192), M266 (≠ V287), V293 (≠ T314), V400 (≠ A419), G426 (≠ S445), M428 (= M447), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ F506), M485 (≠ V508), V486 (≠ I509), W489 (≠ L512)
- binding flavin-adenine dinucleotide: R161 (≠ D182), G222 (= G241), G223 (= G242), G224 (= G243), T246 (= T267), L247 (≠ I268), M248 (≠ A269), M263 (≠ P284), L264 (≠ I285), G286 (= G307), R288 (= R309), V293 (≠ T314), D310 (≠ N331), I311 (≠ A332), D329 (= D348), V330 (≠ A349), M405 (≠ A424), G423 (≠ F442), G424 (= G443)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ V287), D291 (= D312), R292 (≠ F313), M485 (≠ V508), W489 (≠ L512)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ A419), G401 (= G420), Q402 (≠ G421), H403 (≠ L422), M428 (= M447), D453 (= D476), G454 (= G477), S455 (= S478), M458 (= M481), N480 (= N503), H482 (≠ G505), L483 (≠ F506), G484 (≠ A507), M485 (≠ V508), V486 (≠ I509)
Sites not aligning to the query:
- active site: 33, 35, 36, 37, 38, 558
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: 568
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
22% identity, 81% coverage: 58:564/624 of query aligns to 52:541/582 of 5k6tA
- active site: E59 (= E69), T82 (≠ S94), F121 (= F150), Q122 (≠ K151), E123 (≠ P152), K171 (≠ Q192), M266 (≠ V287), V293 (≠ T314), V400 (≠ A419), G426 (≠ S445), M428 (= M447), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ F506), M485 (≠ V508), V486 (≠ I509), W489 (≠ L512)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ T288), R292 (≠ F313), M485 (≠ V508), W489 (≠ L512)
- binding flavin-adenine dinucleotide: R161 (≠ D182), G222 (= G241), G223 (= G242), G224 (= G243), T246 (= T267), L247 (≠ I268), M248 (≠ A269), L264 (≠ I285), G286 (= G307), R288 (= R309), D290 (≠ Q311), R292 (≠ F313), V293 (≠ T314), D310 (≠ N331), I311 (≠ A332), D329 (= D348), V330 (≠ A349), Q404 (≠ P423), M405 (≠ A424), G423 (≠ F442)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ A419), G401 (= G420), Q402 (≠ G421), H403 (≠ L422), G426 (≠ S445), M428 (= M447), G452 (= G475), G454 (= G477), S455 (= S478), N480 (= N503), H482 (≠ G505), L483 (≠ F506), G484 (≠ A507)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
22% identity, 81% coverage: 58:564/624 of query aligns to 52:541/582 of 5k6rA
- active site: E59 (= E69), T82 (≠ S94), F121 (= F150), Q122 (≠ K151), E123 (≠ P152), K171 (≠ Q192), M266 (≠ V287), V293 (≠ T314), V400 (≠ A419), G426 (≠ S445), M428 (= M447), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ F506), M485 (≠ V508), V486 (≠ I509), W489 (≠ L512)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (≠ F313), W489 (≠ L512)
- binding flavin-adenine dinucleotide: R161 (≠ D182), G222 (= G241), G223 (= G242), G224 (= G243), T246 (= T267), L247 (≠ I268), M248 (≠ A269), L264 (≠ I285), M266 (≠ V287), G286 (= G307), R288 (= R309), R292 (≠ F313), V293 (≠ T314), D310 (≠ N331), I311 (≠ A332), G328 (= G347), D329 (= D348), V330 (≠ A349), M405 (≠ A424), G423 (≠ F442)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ A419), G401 (= G420), Q402 (≠ G421), H403 (≠ L422), G426 (≠ S445), M428 (= M447), D453 (= D476), G454 (= G477), S455 (= S478), M458 (= M481), N480 (= N503), H482 (≠ G505), L483 (≠ F506), G484 (≠ A507), M485 (≠ V508), V486 (≠ I509)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
22% identity, 81% coverage: 58:564/624 of query aligns to 52:541/582 of 1z8nA
- active site: E59 (= E69), T82 (≠ S94), F121 (= F150), Q122 (≠ K151), E123 (≠ P152), K171 (≠ Q192), M266 (≠ V287), V293 (≠ T314), V400 (≠ A419), G426 (≠ S445), M428 (= M447), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ F506), M485 (≠ V508), V486 (≠ I509), W489 (≠ L512)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (≠ R159), R161 (≠ D182), Y191 (≠ F206), R194 (≠ K209), D291 (= D312), R292 (≠ F313), D312 (≠ A333), W489 (≠ L512)
- binding flavin-adenine dinucleotide: R161 (≠ D182), G222 (= G241), G224 (= G243), T246 (= T267), L247 (≠ I268), M248 (≠ A269), L264 (≠ I285), G265 (= G286), M266 (≠ V287), H267 (≠ T288), G286 (= G307), V287 (≠ T308), R288 (= R309), D290 (≠ Q311), R292 (≠ F313), V293 (≠ T314), D310 (≠ N331), I311 (≠ A332), D329 (= D348), V330 (≠ A349), M405 (≠ A424), G423 (≠ F442), G424 (= G443)
- binding magnesium ion: D453 (= D476), N480 (= N503)
- binding thiamine diphosphate: V400 (≠ A419), G401 (= G420), Q402 (≠ G421), H403 (≠ L422), G426 (≠ S445), M428 (= M447), G452 (= G475), G454 (= G477), S455 (= S478), N480 (= N503), H482 (≠ G505), L483 (≠ F506), G484 (≠ A507), M485 (≠ V508), V486 (≠ I509)
Sites not aligning to the query:
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
22% identity, 81% coverage: 58:564/624 of query aligns to 52:541/582 of 1yi1A
- active site: E59 (= E69), T82 (≠ S94), F121 (= F150), Q122 (≠ K151), E123 (≠ P152), K171 (≠ Q192), M266 (≠ V287), V293 (≠ T314), V400 (≠ A419), G426 (≠ S445), M428 (= M447), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ F506), M485 (≠ V508), V486 (≠ I509), W489 (≠ L512)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D312), R292 (≠ F313), W489 (≠ L512)
- binding flavin-adenine dinucleotide: R161 (≠ D182), G223 (= G242), G224 (= G243), T246 (= T267), L247 (≠ I268), M248 (≠ A269), M263 (≠ P284), L264 (≠ I285), G265 (= G286), M266 (≠ V287), H267 (≠ T288), G286 (= G307), V287 (≠ T308), R288 (= R309), D290 (≠ Q311), V293 (≠ T314), D310 (≠ N331), I311 (≠ A332), D329 (= D348), V330 (≠ A349), M405 (≠ A424), G423 (≠ F442), G424 (= G443)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
Sites not aligning to the query:
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
22% identity, 81% coverage: 58:564/624 of query aligns to 52:541/582 of 1yi0A
- active site: E59 (= E69), T82 (≠ S94), F121 (= F150), Q122 (≠ K151), E123 (≠ P152), K171 (≠ Q192), M266 (≠ V287), V293 (≠ T314), V400 (≠ A419), G426 (≠ S445), M428 (= M447), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ F506), M485 (≠ V508), V486 (≠ I509), W489 (≠ L512)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D312), R292 (≠ F313), W489 (≠ L512)
- binding flavin-adenine dinucleotide: R161 (≠ D182), G222 (= G241), G223 (= G242), G224 (= G243), T246 (= T267), L247 (≠ I268), M248 (≠ A269), L264 (≠ I285), G265 (= G286), M266 (≠ V287), H267 (≠ T288), G286 (= G307), V287 (≠ T308), R288 (= R309), D290 (≠ Q311), R292 (≠ F313), V293 (≠ T314), D310 (≠ N331), I311 (≠ A332), G328 (= G347), D329 (= D348), V330 (≠ A349), M405 (≠ A424), G423 (≠ F442), G424 (= G443)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
Sites not aligning to the query:
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
22% identity, 81% coverage: 58:564/624 of query aligns to 52:541/582 of 1yhzA
- active site: E59 (= E69), T82 (≠ S94), F121 (= F150), Q122 (≠ K151), E123 (≠ P152), K171 (≠ Q192), M266 (≠ V287), V293 (≠ T314), V400 (≠ A419), G426 (≠ S445), M428 (= M447), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ F506), M485 (≠ V508), V486 (≠ I509), W489 (≠ L512)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D312), R292 (≠ F313), M485 (≠ V508), W489 (≠ L512)
- binding flavin-adenine dinucleotide: R161 (≠ D182), G223 (= G242), G224 (= G243), T246 (= T267), L247 (≠ I268), M248 (≠ A269), L264 (≠ I285), M266 (≠ V287), H267 (≠ T288), G286 (= G307), V287 (≠ T308), R288 (= R309), D290 (≠ Q311), V293 (≠ T314), D310 (≠ N331), I311 (≠ A332), D329 (= D348), V330 (≠ A349), Q404 (≠ P423), M405 (≠ A424), G423 (≠ F442), G424 (= G443)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
Sites not aligning to the query:
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
22% identity, 81% coverage: 58:564/624 of query aligns to 52:541/582 of 1yhyA
- active site: E59 (= E69), T82 (≠ S94), F121 (= F150), Q122 (≠ K151), E123 (≠ P152), K171 (≠ Q192), M266 (≠ V287), V293 (≠ T314), V400 (≠ A419), G426 (≠ S445), M428 (= M447), D453 (= D476), N480 (= N503), H482 (≠ G505), L483 (≠ F506), M485 (≠ V508), V486 (≠ I509), W489 (≠ L512)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D312), R292 (≠ F313), V486 (≠ I509), W489 (≠ L512)
- binding flavin-adenine dinucleotide: R161 (≠ D182), G222 (= G241), G223 (= G242), G224 (= G243), T246 (= T267), L247 (≠ I268), M248 (≠ A269), L264 (≠ I285), G265 (= G286), M266 (≠ V287), H267 (≠ T288), G286 (= G307), V287 (≠ T308), R288 (= R309), D290 (≠ Q311), V293 (≠ T314), D310 (≠ N331), I311 (≠ A332), D329 (= D348), V330 (≠ A349), Q404 (≠ P423), M405 (≠ A424), G423 (≠ F442), G424 (= G443)
- binding magnesium ion: D453 (= D476), N480 (= N503), H482 (≠ G505)
Sites not aligning to the query:
Query Sequence
>GFF710 FitnessBrowser__Phaeo:GFF710
MTTPPKTVKLTTAQAIIRWLSNQFIEVDGEELRLCGGGFGIFGHGNVTCLGEALYEARDA
LPLYRGQNEQSMGFAAAGYAKQWLRQRFMFCTASAGPGTSNLLTSAALAHANRLPMLMLC
GDTFLTRLPDPVLQQMENFNDPTFGVNDAFKPVSRYWDRITHPAQIIQSLPAAIATMLDP
GDCGPAFLGLPQDVQGWTYDYPEVFFEKKIHRIRRVTPDASEIAEAAAALRGAKRPMIIA
GGGVQYSRAVAELTAFAETHQIPVVETIAGRANLRDTHPLNIGPIGVTGSDSANAIAAEA
DVILAVGTRLQDFTTGSWTAFAQDAQFISINAARHDAGKHRSLPVVGDAQRALRDLGAAC
EGYSTPQDWVARAQEERHSWVAYVADNVSYGDNRPNSYAQAIGVVNALCNPKDRVVAAAG
GLPAEVTANWRTLEPGTVDVEFGFSCMGYEIAGAWGARIAQAEREPDRDTIVFVGDGSYM
MLNSDIYSSVLSQKKLIILVLDNGGFAVINKLQNNTGNTSFNNLLEDCPTIPEAFGVDFA
SHAASMGALTETVANPAELGEAFKRAQASDRTTVIVMKVDAYEGWTTEGHAWWEVGTPHI
TNDPKVQEAHVDWESSRSRQRRGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory