SitesBLAST
Comparing GFF711 FitnessBrowser__Phaeo:GFF711 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yaqB Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with scyllo-inosose (see paper)
43% identity, 86% coverage: 38:383/401 of query aligns to 2:351/366 of 5yaqB
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K100 (= K137), Y129 (= Y166), Y157 (≠ H194), E159 (= E196), R172 (= R209), D185 (= D220), H189 (= H224)
- binding nicotinamide-adenine-dinucleotide: G8 (= G44), T9 (≠ G45), G10 (= G46), F11 (≠ Y47), M12 (= M48), D39 (≠ A76), M40 (≠ T77), T76 (≠ A113), T77 (≠ S114), N79 (≠ Q116), H82 (= H119), E99 (= E136), K100 (= K137), N128 (= N165), R172 (= R209), H189 (= H224)
5ya8A Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with myo-inositol (see paper)
43% identity, 86% coverage: 38:383/401 of query aligns to 2:351/366 of 5ya8A
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K100 (= K137), Y129 (= Y166), Y157 (≠ H194), E159 (= E196), R172 (= R209), D185 (= D220), H189 (= H224)
- binding nicotinamide-adenine-dinucleotide: T9 (≠ G45), G10 (= G46), F11 (≠ Y47), M12 (= M48), D39 (≠ A76), M40 (≠ T77), T76 (≠ A113), T77 (≠ S114), P78 (= P115), N79 (≠ Q116), H82 (= H119), E99 (= E136), K100 (= K137), N128 (= N165), H189 (= H224)
6ktkC Crystal structure of scyllo-inositol dehydrogenase r178a mutant, complexed with nadh and l-glucono-1,5-lactone, from paracoccus laeviglucosivorans (see paper)
43% identity, 86% coverage: 38:383/401 of query aligns to 3:352/368 of 6ktkC
- binding L-glucono-1,5-lactone: K101 (= K137), Y130 (= Y166), Y158 (≠ H194), E160 (= E196), Y162 (≠ F198), D186 (= D220), H190 (= H224)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T10 (≠ G45), G11 (= G46), F12 (≠ Y47), M13 (= M48), D40 (≠ A76), M41 (≠ T77), T77 (≠ A113), T78 (≠ S114), N80 (≠ Q116), H83 (= H119), E100 (= E136), K101 (= K137), N129 (= N165), H190 (= H224)
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
37% identity, 90% coverage: 37:398/401 of query aligns to 2:369/372 of 6a3iA
- binding Levoglucosan: K103 (= K137), Y132 (= Y166), Y160 (≠ H194), Q162 (≠ E196), R175 (= R209), D188 (= D220), H192 (= H224)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F12 (≠ Y47), M13 (= M48), E42 (≠ A76), A43 (≠ T77), P81 (= P115), N82 (≠ Q116), L84 (≠ T118), H85 (= H119), E102 (= E136), K103 (= K137), W174 (= W208), R175 (= R209)
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
36% identity, 90% coverage: 37:398/401 of query aligns to 1:373/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G46), F11 (≠ Y47), M12 (= M48), E41 (≠ A76), T79 (≠ S114), P80 (= P115), N81 (≠ Q116), H84 (= H119), E101 (= E136), K102 (= K137), W173 (= W208), R174 (= R209)
- binding alpha-L-sorbopyranose: K102 (= K137), Y131 (= Y166), Y159 (≠ H194), Q161 (≠ E196), W163 (≠ F198), R174 (= R209), D187 (= D220)
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
35% identity, 91% coverage: 35:398/401 of query aligns to 1:385/390 of F0M433
- F13 (≠ Y47) binding
- M14 (= M48) binding
- E43 (≠ A76) binding
- T81 (≠ S114) binding
- N83 (≠ Q116) binding
- H86 (= H119) binding
- E103 (= E136) binding
- K104 (= K137) binding ; binding
- A130 (≠ G163) binding
- N132 (= N165) binding
- Y133 (= Y166) binding
- Q163 (≠ E196) binding
- W175 (= W208) binding
- R176 (= R209) binding ; binding
- D189 (= D220) binding
- H193 (= H224) binding
- Y335 (= Y348) binding
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
27% identity, 80% coverage: 38:356/401 of query aligns to 2:300/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G46), F11 (≠ Y47), M12 (= M48), D33 (≠ A76), L34 (≠ T77), T70 (≠ A113), T71 (≠ S114), P72 (= P115), N73 (≠ Q116), L75 (≠ T118), H76 (= H119), Q79 (≠ V122), E93 (= E136), K94 (= K137), N122 (= N165), W161 (= W208), H179 (= H224), Y290 (≠ H344)
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
27% identity, 80% coverage: 38:356/401 of query aligns to 2:300/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ Y47), F152 (≠ Y199), N154 (≠ D201), D175 (= D220), L176 (= L221), H179 (= H224), E236 (≠ K285), W271 (≠ L327)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G46), F11 (≠ Y47), M12 (= M48), D33 (≠ A76), L34 (≠ T77), T70 (≠ A113), T71 (≠ S114), P72 (= P115), N73 (≠ Q116), L75 (≠ T118), H76 (= H119), Q79 (≠ V122), E93 (= E136), K94 (= K137), N122 (= N165), W161 (= W208), H179 (= H224), Y290 (≠ H344)
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
27% identity, 80% coverage: 38:356/401 of query aligns to 2:300/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ Y47), N154 (≠ D201), D175 (= D220), H179 (= H224), E236 (≠ K285), W271 (≠ L327)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G44), G10 (= G46), F11 (≠ Y47), M12 (= M48), D33 (≠ A76), L34 (≠ T77), T70 (≠ A113), T71 (≠ S114), P72 (= P115), N73 (≠ Q116), L75 (≠ T118), H76 (= H119), Q79 (≠ V122), E93 (= E136), K94 (= K137), N122 (= N165), W161 (= W208), Y290 (≠ H344)
5uiaA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, r-2,3-dihydroxyisovalerate and magnesium
26% identity, 70% coverage: 74:353/401 of query aligns to 32:293/342 of 5uiaA
- binding (2S)-2,3-dihydroxy-3-methylbutanoic acid: K95 (= K137), Q162 (≠ A204), D175 (= D220), H179 (= H224), Y229 (≠ F276)
- binding nicotinamide-adenine-dinucleotide: D34 (≠ A76), R35 (≠ T77), T72 (≠ S114), Q94 (≠ E136), K95 (= K137), N123 (= N165), Q162 (≠ A204), Y164 (≠ W208)
Sites not aligning to the query:
5ui9A Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, 2 -hydroxy-2-hydroxymethyl propanoic acid and magnesium
26% identity, 70% coverage: 74:353/401 of query aligns to 32:293/342 of 5ui9A
- binding (2S)-2,3-dihydroxy-2-methylpropanoic acid: K95 (= K137), Q162 (≠ A204), D175 (= D220), H179 (= H224), Y229 (≠ F276), W285 (≠ G343)
- binding nicotinamide-adenine-dinucleotide: D34 (≠ A76), R35 (≠ T77), T72 (≠ S114), S76 (≠ T118), Q94 (≠ E136), K95 (= K137), P96 (= P138), N123 (= N165), Q162 (≠ A204), Y164 (≠ W208)
Sites not aligning to the query:
5uhzA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, d-apionate and magnesium
26% identity, 70% coverage: 74:353/401 of query aligns to 32:293/342 of 5uhzA
- binding (3R,4R)-3,4-dihydroxy-4-(hydroxymethyl)oxolan-2-one: K95 (= K137), Q162 (≠ A204), D175 (= D220), H179 (= H224), Y229 (≠ F276)
- binding nicotinamide-adenine-dinucleotide: D34 (≠ A76), R35 (≠ T77), T72 (≠ S114), S76 (≠ T118), Q94 (≠ E136), K95 (= K137), P96 (= P138), N123 (= N165), Q162 (≠ A204), Y164 (≠ W208)
Sites not aligning to the query:
5uhwA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+ and magnesium
26% identity, 70% coverage: 74:353/401 of query aligns to 32:293/342 of 5uhwA
Sites not aligning to the query:
B9JK80 D-apiose dehydrogenase; EC 1.1.1.420 from Rhizobium rhizogenes (strain K84 / ATCC BAA-868) (Agrobacterium radiobacter)
25% identity, 80% coverage: 35:353/401 of query aligns to 3:296/345 of B9JK80
- FF 15:16 (≠ Y- 47) binding
- W24 (vs. gap) binding
- K25 (vs. gap) binding
- V27 (= V54) binding
- A30 (= A57) binding
- D37 (≠ A76) binding
- S79 (≠ T118) binding
- QK 97:98 (≠ EK 136:137) binding
- N126 (= N165) binding
- QP--Y 165:167 (≠ APATW 204:208) binding
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
26% identity, 89% coverage: 38:392/401 of query aligns to 3:329/340 of 4n54A
- active site: K96 (= K137), H183 (= H224)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (≠ Y47), K96 (= K137), D156 (= D201), D179 (= D220), M180 (≠ L221), H183 (= H224), R238 (= R284), Y244 (= Y290)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ L43), G9 (= G44), L10 (≠ G45), G11 (= G46), R12 (≠ Y47), L13 (≠ M48), S35 (≠ A76), V36 (≠ T77), E40 (≠ S81), S73 (= S114), P74 (= P115), F77 (≠ T118), H78 (= H119), E95 (= E136), K96 (= K137), M125 (≠ N165), F167 (≠ W208), F284 (= F338)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
25% identity, 66% coverage: 37:302/401 of query aligns to 2:258/335 of 5a05A
- active site: K100 (= K137), Y185 (≠ H224)
- binding beta-D-glucopyranose: K100 (= K137), F159 (≠ E196), D181 (= D220), Y185 (≠ H224)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G44), L10 (≠ G45), G11 (= G46), Y12 (= Y47), Y13 (≠ M48), S35 (≠ A76), G36 (≠ T77), T37 (≠ S78), K40 (≠ S81), Y58 (≠ T95), I76 (≠ A113), T77 (≠ S114), P78 (= P115), N79 (≠ Q116), L81 (≠ T118), H82 (= H119), E99 (= E136), K100 (= K137), R128 (≠ N165), W167 (= W208), R168 (= R209), Y185 (≠ H224)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
25% identity, 66% coverage: 37:302/401 of query aligns to 2:258/335 of 5a04A
- active site: K100 (= K137), Y185 (≠ H224)
- binding beta-D-glucopyranose: K100 (= K137), F159 (≠ E196), R168 (= R209), D181 (= D220), Y185 (≠ H224)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ G45), G11 (= G46), Y12 (= Y47), Y13 (≠ M48), S35 (≠ A76), G36 (≠ T77), T37 (≠ S78), K40 (≠ S81), Y58 (≠ T95), I76 (≠ A113), T77 (≠ S114), P78 (= P115), N79 (≠ Q116), L81 (≠ T118), H82 (= H119), E99 (= E136), K100 (= K137), R128 (≠ N165), W167 (= W208), R168 (= R209), Y185 (≠ H224)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
25% identity, 66% coverage: 37:302/401 of query aligns to 2:258/335 of 5a03E
- active site: K100 (= K137), Y185 (≠ H224)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G44), L10 (≠ G45), G11 (= G46), Y12 (= Y47), Y13 (≠ M48), S35 (≠ A76), G36 (≠ T77), T37 (≠ S78), K40 (≠ S81), Y58 (≠ T95), I76 (≠ A113), T77 (≠ S114), P78 (= P115), N79 (≠ Q116), H82 (= H119), E99 (= E136), K100 (= K137), R128 (≠ N165), W167 (= W208), R168 (= R209), Y185 (≠ H224)
- binding beta-D-xylopyranose: K100 (= K137), F159 (≠ E196), R168 (= R209), D181 (= D220), Y185 (≠ H224), E205 (= E244), T207 (≠ V246), R209 (≠ T248)
- binding alpha-D-xylopyranose: H134 (≠ A171)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
25% identity, 66% coverage: 37:302/401 of query aligns to 2:258/335 of 5a02A
- active site: K100 (= K137), Y185 (≠ H224)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (≠ G45), G11 (= G46), Y12 (= Y47), Y13 (≠ M48), S35 (≠ A76), G36 (≠ T77), T37 (≠ S78), K40 (≠ S81), Y58 (≠ T95), I76 (≠ A113), T77 (≠ S114), P78 (= P115), L81 (≠ T118), H82 (= H119), E99 (= E136), K100 (= K137), R128 (≠ N165), W167 (= W208), R168 (= R209), Y185 (≠ H224)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
25% identity, 66% coverage: 37:302/401 of query aligns to 3:259/336 of 5a06A
- active site: K101 (= K137), Y186 (≠ H224)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (≠ G45), G12 (= G46), Y13 (= Y47), Y14 (≠ M48), S36 (≠ A76), G37 (≠ T77), T38 (≠ S78), K41 (≠ S81), Y59 (≠ T95), I77 (≠ A113), T78 (≠ S114), P79 (= P115), N80 (≠ Q116), L82 (≠ T118), H83 (= H119), E100 (= E136), K101 (= K137), R129 (≠ N165), W168 (= W208), R169 (= R209), Y186 (≠ H224)
- binding sorbitol: D72 (≠ E108), H96 (≠ P132), K101 (= K137), R122 (≠ C158), R122 (≠ C158), L124 (≠ N160), F160 (≠ E196), R169 (= R209), D182 (= D220), Y186 (≠ H224)
Sites not aligning to the query:
Query Sequence
>GFF711 FitnessBrowser__Phaeo:GFF711
MVCGRVDLILRDVESQDTSFATGCKLNLMVWEARMTEIGIGILGGGYMGKAHAVAMAAVG
AVFDTALRPRLEMVCATSPVSAERYRKAYGFQRATDDWQVLVNDPKVEAIVIASPQQTHR
VVAEAAFALGKPVFCEKPLGASLADSRAMVAAAQSSGCPNMVGFNYIRTPASQYARQLIA
DGLIGEVTWFRGEHTEDFYADPDAPATWRTEGEANGTMGDLAPHMINGAMALIGPIAELI
AEVETVHTDRPGGRVTNDDQGQLMCRFANGAMGQMFFSRIATGRKMGYAYEITGTKGAIR
FDQEDQNALWLYLSEGDEATRGFRKILTGPAHPDYLPFCQGPGHGTGYQDQILIEARDFL
RAIETQTPVWPTFEDGMAVNQVIAAAMAASEARSWQTVSTF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory