Comparing GFF717 FitnessBrowser__Phaeo:GFF717 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
33% identity, 93% coverage: 5:246/261 of query aligns to 2:239/501 of P04983
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 84% coverage: 7:224/261 of query aligns to 1:212/240 of 4ymuJ
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
31% identity, 96% coverage: 8:258/261 of query aligns to 7:242/353 of 1vciA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 88% coverage: 6:235/261 of query aligns to 1:223/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 88% coverage: 7:235/261 of query aligns to 3:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 88% coverage: 7:235/261 of query aligns to 3:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 88% coverage: 7:235/261 of query aligns to 3:225/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 88% coverage: 7:235/261 of query aligns to 3:225/242 of 2oljA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
30% identity, 92% coverage: 8:246/261 of query aligns to 7:241/375 of 2d62A
1g291 Malk (see paper)
34% identity, 83% coverage: 8:224/261 of query aligns to 4:216/372 of 1g291
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 88% coverage: 7:235/261 of query aligns to 1:215/348 of 3d31A
Sites not aligning to the query:
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
27% identity, 91% coverage: 3:240/261 of query aligns to 2:231/240 of 1ji0A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 84% coverage: 6:225/261 of query aligns to 16:225/378 of P69874
Sites not aligning to the query:
F1MWM0 Retinal-specific phospholipid-transporting ATPase ABCA4; ATP-binding cassette sub-family A member 4; RIM ABC transporter; RIM protein; RmP; Retinal-specific ATP-binding cassette transporter; EC 7.6.2.1 from Bos taurus (Bovine) (see 2 papers)
28% identity, 86% coverage: 7:231/261 of query aligns to 1935:2153/2281 of F1MWM0
Sites not aligning to the query:
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
33% identity, 82% coverage: 17:229/261 of query aligns to 18:218/218 of 7w78A
Sites not aligning to the query:
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 91% coverage: 10:246/261 of query aligns to 1:246/265 of P07821
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 84% coverage: 7:225/261 of query aligns to 1:218/343 of P30750
Sites not aligning to the query:
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 92% coverage: 7:245/261 of query aligns to 4:243/254 of 1g6hA
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
27% identity, 84% coverage: 8:226/261 of query aligns to 4:212/371 of P68187
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 92% coverage: 7:245/261 of query aligns to 4:243/253 of 1g9xB
>GFF717 FitnessBrowser__Phaeo:GFF717
MSMSQPLIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPT
KGDILFEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFD
HDYANRITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALG
VRQTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEEL
QDMMAGGQELATLEGSLGGTV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory