Comparing GFF726 FitnessBrowser__Phaeo:GFF726 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
31% identity, 89% coverage: 9:289/315 of query aligns to 5:288/313 of P94529
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
32% identity, 86% coverage: 25:294/315 of query aligns to 3:266/285 of 7cagA
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
24% identity, 76% coverage: 57:296/315 of query aligns to 222:483/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
25% identity, 71% coverage: 73:296/315 of query aligns to 260:498/514 of P02916
>GFF726 FitnessBrowser__Phaeo:GFF726
MAEMNLAPETGSSATSPGASESWLRRNRQALAPWLFLAPGVIFFLFYVIFPILQSFNLSF
YRWDGLGDPQFIGMENYRELMDDRAFEVSLWNNLKWLLLYLLAIPAGLFIALFLNQTVTG
IRLYKSLFFFPFVISQVVVGLVFSWFYDPTFGLLNQVLAWVGLGPINVLGDPTLVTYGII
IAGLWPQTAYCMILYLTGLNAVDPEQVEAARLDGAKGAKMLWYVIIPQLRPATFVAFVVT
IIGALRSFDLISIMTNGGPFGSSRVLSFYMFEKALSEYGFRMGYGAAIAVVLFLIMLCFI
AYFLWSMYQDDKGGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory