Comparing GFF734 FitnessBrowser__WCS417:GFF734 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
52% identity, 99% coverage: 4:695/699 of query aligns to 5:712/714 of Q8ZND6
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
41% identity, 45% coverage: 378:692/699 of query aligns to 11:334/339 of 6ioxA
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
41% identity, 46% coverage: 374:693/699 of query aligns to 3:328/332 of 2af3C
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
41% identity, 46% coverage: 374:693/699 of query aligns to 4:329/333 of P38503
Sites not aligning to the query:
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
41% identity, 44% coverage: 388:692/699 of query aligns to 20:324/325 of 1xcoD
6zngF Maeb full-length acetyl-coa bound state (see paper)
34% identity, 47% coverage: 364:692/699 of query aligns to 414:743/753 of 6zngF
Sites not aligning to the query:
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
28% identity, 46% coverage: 373:697/699 of query aligns to 429:759/759 of P76558
Sites not aligning to the query:
7t85A Crystal structure of the n-terminal domain of the phosphate acetyltransferase from escherichia coli
38% identity, 27% coverage: 4:192/699 of query aligns to 5:169/173 of 7t85A
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
29% identity, 21% coverage: 532:675/699 of query aligns to 127:272/285 of 3uf6A
Sites not aligning to the query:
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
29% identity, 21% coverage: 532:675/699 of query aligns to 129:274/288 of 3u9eB
Sites not aligning to the query:
>GFF734 FitnessBrowser__WCS417:GFF734
MQTFFIAPTDFGVGLTSISLGLVRTLERAGLKVGFFKPIAQPHPGDTGPERSTELVARTH
GLKPPQPLGLAHVERMLGDGQLDELLEEIITLYQQAAVGKDVLIVEGMVPTRSASYAARV
NLHLAKSLDAEVILVSAPENEVLTELSGRVELQAQLFGGPKDPKVLGVILNKVRTDESME
AFSARLKEHSPLLRSGDFRLLGCIPYQPELNAPRTRDVADLMGAQILNAGDYETRRMTKI
IICARTMRNTVELLKPGVLVVTPGDRDDIILAVSLAAINGVPLAGLLLTSDTLPDPRIME
LCRGAFQAGLPVLSVSTGSYDTANQLNSLNKEIPIDDRERAEIITDFVASHLDARWLHQR
CGTPREMRLSPAVFRYQLIQRAQAANKRIVLPEGSEPLTVQAAAICQARGIARCVLLAKP
ADVEAVARAQGIELPEGLEILDPDLIRQRYVEPMVALRKSKSLNAPMAEQQLEDTVVIAT
MMLALDEVDGLVSGVIHSTANTIRPALQLIKTAPGCTLVSSVFFMLFPEQVLVYGDCVMN
PHPSAAELAEIALQSADSAAAFGITPRVAMISYSSGDSASGEEVEKVREATLLAHEQQSS
LLIDGPLQYDAAANENVARQLAPNSQVAGKATVFVFPDLNTGNTTHKAVQRSADCVSLGP
MLQGLRKPVNDLPRGAQVDDIVYTIALTAIQAANRPMDI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory