SitesBLAST
Comparing GFF747 FitnessBrowser__Phaeo:GFF747 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
50% identity, 95% coverage: 16:363/366 of query aligns to 2:352/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
50% identity, 93% coverage: 16:356/366 of query aligns to 5:341/341 of 7xntA
- binding 3-(2,6-dimethylphenyl)-1-methyl-6-(2-oxidanyl-6-oxidanylidene-cyclohexen-1-yl)carbonyl-quinazoline-2,4-dione: H161 (= H168), T163 (= T170), S201 (= S208), P214 (= P221), Q221 (= Q231), H236 (= H246), F304 (= F319), F313 (= F328), F325 (= F340), F330 (= F345)
- binding cobalt (ii) ion: H161 (= H168), H236 (= H246), E315 (= E330)
7x8eA Crystal structure of pfhppd-y13287 complex
49% identity, 94% coverage: 16:360/366 of query aligns to 4:341/341 of 7x8eA
- binding 1,5-dimethyl-3-(2-methylphenyl)-6-(2-oxidanyl-6-oxidanylidene-cyclohexen-1-yl)carbonyl-quinazoline-2,4-dione: S193 (= S208), P206 (= P221), Q214 (= Q231), H229 (= H246), M252 (= M269), F300 (= F319), F321 (= F340), F326 (= F345)
- binding cobalt (ii) ion: H160 (= H168), H229 (= H246), E311 (= E330)
7xntC Crystal structure of pfhppd-y13161 complex
47% identity, 92% coverage: 16:351/366 of query aligns to 4:320/320 of 7xntC
- binding 3-(2,6-dimethylphenyl)-1-methyl-6-(2-oxidanyl-6-oxidanylidene-cyclohexen-1-yl)carbonyl-quinazoline-2,4-dione: H160 (= H168), T162 (= T170), P201 (= P221), Q206 (= Q231), H221 (= H246), M244 (= M269), F288 (= F319), F309 (= F340), G310 (= G341), N313 (= N344), F314 (= F345)
- binding cobalt (ii) ion: H160 (= H168), H221 (= H246), E299 (= E330)
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
31% identity, 95% coverage: 9:356/366 of query aligns to 283:623/624 of 5hmqD
Sites not aligning to the query:
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
30% identity, 95% coverage: 9:356/366 of query aligns to 281:626/635 of Q88JU3
- H443 (= H168) binding
- H521 (= H246) binding
- E599 (= E330) binding
Sites not aligning to the query:
- 134 binding
- 165 binding
- 168 H→A: 21-fold decrease in turnover rate.
- 191 binding
- 206 S→A: 10-fold decrease in the affinity for dehydroshikimate without significantly altering the turnover rate.
- 239 binding
1t47A Structure of fe2-hppd bound to ntbc (see paper)
34% identity, 77% coverage: 75:356/366 of query aligns to 71:360/362 of 1t47A
- binding fe (ii) ion: H172 (= H168), H255 (= H246), E334 (= E330)
- binding 2-{hydroxy[2-nitro-4-(trifluoromethyl)phenyl]methylene}cyclohexane-1,3-dione: H172 (= H168), S215 (= S208), P228 (= P221), H255 (= H246), F321 (= F319), E334 (= E330), F344 (= F340), G345 (= G341), N348 (= N344), F349 (= F345), L352 (= L348)
7yvvA Acmp1, r-4-hydroxymandelate synthase
31% identity, 75% coverage: 81:356/366 of query aligns to 66:334/335 of 7yvvA
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
29% identity, 89% coverage: 41:365/366 of query aligns to 29:355/357 of O52791
- S201 (= S208) binding
- T214 (≠ P221) binding
- H241 (= H246) binding
- Q305 (= Q317) binding
2r5vA Hydroxymandelate synthase crystal structure (see paper)
29% identity, 86% coverage: 41:356/366 of query aligns to 28:344/346 of 2r5vA
- binding cobalt (ii) ion: H159 (= H168), H239 (= H246), E318 (= E330)
- binding (2S)-hydroxy(4-hydroxyphenyl)ethanoic acid: H159 (= H168), F186 (≠ R195), S199 (= S208), V201 (≠ A210), T212 (≠ P221), H239 (= H246), Q303 (= Q317), E318 (= E330), F328 (= F340), I333 (≠ F345)
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 89% coverage: 43:366/366 of query aligns to 39:385/393 of P32755
- H183 (= H168) binding
- H266 (= H246) binding
- E349 (= E330) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylthreonine
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
30% identity, 56% coverage: 161:366/366 of query aligns to 176:385/393 of Q02110
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylthreonine
5ywgA Crystal structure of arabidopsis thaliana hppd complexed with mesotrione (see paper)
30% identity, 80% coverage: 60:353/366 of query aligns to 61:364/366 of 5ywgA
- binding 2-[(4-methylsulfonyl-2-nitro-phenyl)-oxidanyl-methylidene]cyclohexane-1,3-dione: H180 (= H168), S212 (= S208), P225 (= P221), H248 (= H246), F321 (= F319), F332 (= F328), F351 (= F340), G352 (= G341), K353 (≠ E342), F356 (= F345)
- binding cobalt (ii) ion: H180 (= H168), H248 (= H246), E334 (= E330)
5ywhA Crystal structure of arabidopsis thaliana hppd complexed with y13508
30% identity, 75% coverage: 78:353/366 of query aligns to 93:370/372 of 5ywhA
- binding [1,3-diethyl-2,2-bis(oxidanylidene)-2$l^{6},1,3-benzothiadiazol-5-yl]-(1-methyl-5-oxidanyl-pyrazol-4-yl)methanone: M281 (= M269), F327 (= F319), F338 (= F328), F357 (= F340), G358 (= G341), N361 (= N344), F362 (= F345)
- binding fe (iii) ion: H184 (= H168), H254 (= H246), E340 (= E330)
7x5wA Crystal structure of athppd-y18022 complex
29% identity, 79% coverage: 64:353/366 of query aligns to 76:377/381 of 7x5wA
- binding 1,5-dimethyl-3-naphthalen-1-yl-6-(2-oxidanyl-6-oxidanylidene-cyclohexen-1-yl)carbonyl-quinazoline-2,4-dione: H187 (= H168), S219 (= S208), R242 (vs. gap), Q245 (= Q231), H260 (= H246), M287 (= M269), F333 (= F319), E346 (= E330), F364 (vs. gap), K366 (vs. gap), N368 (= N344), F369 (= F345)
- binding cobalt (ii) ion: H187 (= H168), H260 (= H246), E346 (= E330)
1tg5A Crystal structures of plant 4-hydroxyphenylpyruvate dioxygenases complexed with das645 (see paper)
31% identity, 79% coverage: 64:352/366 of query aligns to 76:371/371 of 1tg5A
- binding [1-tert-butyl-3-(2,4-dichlorophenyl)-5-hydroxy-1h-pyrazol-4-yl][2-chloro-4-(methylsulfonyl)phenyl]methanone: L216 (= L206), P231 (= P221), H257 (= H246), F330 (= F319), F341 (= F328), E343 (= E330), F359 (= F340), G360 (= G341), K361 (≠ E342), N363 (= N344), F364 (= F345), L367 (= L348)
- binding fe (ii) ion: H187 (= H168), H257 (= H246), E343 (= E330)
6isdA Crystal structure of arabidopsis thaliana hppd complexed with sulcotrione (see paper)
30% identity, 75% coverage: 78:353/366 of query aligns to 92:367/369 of 6isdA
- binding 2-[2-chloro-4-(methylsulfonyl)benzoyl]cyclohexane-1,3-dione: H179 (= H168), V181 (≠ T170), S211 (= S208), P224 (= P221), H250 (= H246), F323 (= F319), F334 (= F328), F354 (vs. gap), F359 (= F345)
- binding cobalt (ii) ion: H179 (= H168), H250 (= H246), E336 (= E330)
8i0yA Crystal structure of athppd-y191713 complex
29% identity, 79% coverage: 64:353/366 of query aligns to 76:378/382 of 8i0yA
- binding cobalt (ii) ion: H187 (= H168), H261 (= H246), E347 (= E330)
- binding ethyl 5-methyl-6-[(2-methyl-3-oxidanylidene-1H-pyrazol-4-yl)carbonyl]-4-oxidanylidene-3-phenyl-quinazoline-2-carboxylate: H187 (= H168), P233 (= P221), H261 (= H246), F334 (= F319), E347 (= E330), F365 (vs. gap), G366 (vs. gap), F370 (= F345), L373 (= L348)
7x6nA Crystal structure of athppd-y191710 complex
29% identity, 79% coverage: 64:353/366 of query aligns to 76:378/382 of 7x6nA
- binding ethyl 5-methyl-4-oxidanylidene-6-(2-oxidanyl-6-oxidanylidene-cyclohexen-1-yl)carbonyl-3-phenyl-quinazoline-2-carboxylate: H187 (= H168), S220 (= S208), N235 (= N223), H261 (= H246), F334 (= F319), E347 (= E330), F365 (vs. gap), F370 (= F345), L373 (= L348)
- binding cobalt (ii) ion: H187 (= H168), H261 (= H246), E347 (= E330)
7x8iA Crystal structure of athppd-shikonin complex (see paper)
29% identity, 79% coverage: 64:353/366 of query aligns to 76:376/380 of 7x8iA
- binding cobalt (ii) ion: H186 (= H168), H259 (= H246), E345 (= E330)
- binding 2-[(1R)-4-methyl-1-oxidanyl-pent-3-enyl]-5,8-bis(oxidanyl)naphthalene-1,4-dione: L216 (= L206), Q244 (= Q231), H259 (= H246), F332 (= F319), F343 (= F328), F363 (vs. gap), F368 (= F345)
Query Sequence
>GFF747 FitnessBrowser__Phaeo:GFF747
MGPFPHNAPKSVISPENPAGTDGFEFVEFAHPDPQELRDLFARMGYELVARHKSKPGIEL
WQQGDITYVLNAEKGSFAERFVADHGPCAPSMGWRVVDAQKAFEHAVSKGAEAYEGDDKT
MDVPAIKGIGGSLIYFIDQYYDTSPYNTEFEWLTQSKPRGVGFYYLDHLTHNVFKGNMDK
WFRFYGELFNFKEIRFFDIEGKFTGLLSRALTSPCGRIRIPINEDRGETGQIVSYLKKYN
GEGIQHIAVGSEDIYGATDEISDRGIKFMPAPPASYYEMSHDRVIGHEEPLDRMQKHGIL
IDGEGVVDGGETKILLQIFSKTVIGPIFFEFIQRKGDDGFGEGNFKALFESIEREQIANG
ELAGAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory