Comparing GFF750 FitnessBrowser__Phaeo:GFF750 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7kb1C Complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate (see paper)
49% identity, 99% coverage: 6:430/430 of query aligns to 4:428/428 of 7kb1C
7kb1A Complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate (see paper)
49% identity, 99% coverage: 6:430/430 of query aligns to 4:428/428 of 7kb1A
2ctzA Crystal structure of o-acetyl homoserine sulfhydrylase from thermus thermophilus hb8
48% identity, 97% coverage: 9:426/430 of query aligns to 3:421/421 of 2ctzA
Q5SK88 O-acetyl-L-homoserine sulfhydrylase 1; OAH-sulfhydrylase 1; EC 2.5.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
48% identity, 97% coverage: 9:426/430 of query aligns to 3:421/421 of Q5SK88
O13326 Homocysteine synthase; O-acetylhomoserine sulfhydrylase; OAH SHL; OAH sulfhydrylase; EC 2.5.1.49 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
51% identity, 98% coverage: 9:428/430 of query aligns to 8:429/429 of O13326
8wkoA Crystal structure of o-acetylhomoserine sulfhydrylase from lactobacillus plantarum in the closed form
47% identity, 98% coverage: 6:427/430 of query aligns to 6:424/425 of 8wkoA
8erbK Crystal structure of fub7 in complex with vinylglycine ketimine (see paper)
47% identity, 98% coverage: 9:428/430 of query aligns to 6:427/429 of 8erbK
8erjB Crystal structure of fub7 in complex with e-2-aminocrotonate (see paper)
47% identity, 98% coverage: 9:428/430 of query aligns to 5:426/428 of 8erjB
8erjA Crystal structure of fub7 in complex with e-2-aminocrotonate (see paper)
47% identity, 98% coverage: 9:428/430 of query aligns to 5:426/428 of 8erjA
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
38% identity, 100% coverage: 2:429/430 of query aligns to 1:396/396 of 4hf8A
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
38% identity, 100% coverage: 2:429/430 of query aligns to 1:396/396 of 4omaA
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
38% identity, 100% coverage: 2:429/430 of query aligns to 1:396/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
38% identity, 100% coverage: 2:429/430 of query aligns to 1:396/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
38% identity, 100% coverage: 2:429/430 of query aligns to 1:396/396 of 3jw9A
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
38% identity, 100% coverage: 2:429/430 of query aligns to 1:396/396 of 6egrA
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
38% identity, 99% coverage: 6:429/430 of query aligns to 4:395/395 of 5m3zA
8ovhA Crystal structure of o-acetyl-l-homoserine sulfhydrolase from saccharomyces cerevisiae in complex with pyridoxal-5'-phosphate (see paper)
42% identity, 98% coverage: 5:426/430 of query aligns to 2:392/400 of 8ovhA
3mkjA Methionine gamma-lyase from citrobacter freundii with pyridoximine-5'- phosphate (see paper)
37% identity, 100% coverage: 2:429/430 of query aligns to 1:385/386 of 3mkjA
3vk3A Crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-methionine (see paper)
37% identity, 98% coverage: 8:430/430 of query aligns to 8:397/397 of 3vk3A
5x2xA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-homocysteine intermediates (see paper)
37% identity, 98% coverage: 8:430/430 of query aligns to 3:392/392 of 5x2xA
>GFF750 FitnessBrowser__Phaeo:GFF750
MSEAPSYGFDTLQIHAGAKPDPATGARQTPIYQTTAYVFRDADHAAALFNLQEVGFIYSR
LTNPTVAVLQERIATLEGGVGAVCCSSGHAAQIMALFPLMGPGCNVVASTRLYGGTVTQF
SQTIKRFGWSAKFVDFDNPEAVAAAIDDDTRAVFGESVANPGGYVTDIRSIADVADAAGV
PLIIDNTSATPYLCSPIAHGATLVVHSTTKYLTGNGTVTGGVIVDSGKFDWSANDKFPSL
SQPEPAYHGLKFHETFGGLAFTFHGIAIGLRDLGMTMNPQAAHYTLMGVETLSLRMERHC
ENAKTVASWLEQDPRVDYVTYAGLPSSPYHARAKEHYPKGTGGLFTFAVKGGYDACVKLV
NSLEIFSHVANLGDTRSLIIHSASTTHRQLTPEQQEAAGAGANVVRVSIGIENADDLIAD
LDQALSKASS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory