SitesBLAST
Comparing GFF755 FitnessBrowser__Phaeo:GFF755 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6bfgA Crystal structure of monotopic membrane protein (s)-mandelate dehydrogenase (see paper)
39% identity, 97% coverage: 6:357/363 of query aligns to 3:358/373 of 6bfgA
- active site: Y129 (= Y132), D156 (= D160), H272 (= H269)
- binding flavin mononucleotide: Y24 (= Y27), P77 (= P80), T78 (≠ M81), G79 (= G82), Q127 (= Q130), Y129 (= Y132), T154 (= T158), K248 (= K245), H272 (= H269), G273 (= G270), R275 (= R272), D301 (= D300), S302 (= S301), G303 (= G302), R305 (= R304), G324 (= G323), R325 (= R324)
P20932 (S)-mandelate dehydrogenase; MDH; L(+)-mandelate dehydrogenase; EC 1.1.99.31 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
39% identity, 97% coverage: 6:357/363 of query aligns to 5:360/393 of P20932
- PTG 79:81 (≠ PMG 80:82) binding
- G81 (= G82) mutation to A: 23-fold decrease in catalytic activity with mandelate as substrate and DCPIP as electron acceptor, but no change in affinity for mandelate. Shows a modestly higher reactivity with molecular oxygen.
- S108 (= S109) binding
- Q129 (= Q130) binding
- T156 (= T158) binding
- K250 (= K245) binding
- DSGFR 303:307 (≠ DSGIR 300:304) binding
- GR 326:327 (= GR 323:324) binding
2a85A Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 2- hydroxyoctanoate (see paper)
38% identity, 97% coverage: 6:357/363 of query aligns to 2:338/353 of 2a85A
- active site: S105 (= S109), Y128 (= Y132), T153 (= T158), D155 (= D160), K228 (= K245), H252 (= H269)
- binding flavin mononucleotide: Y23 (= Y27), P76 (= P80), T77 (≠ M81), A78 (≠ G82), S105 (= S109), Q126 (= Q130), Y128 (= Y132), T153 (= T158), K228 (= K245), H252 (= H269), G253 (= G270), R255 (= R272), D281 (= D300), S282 (= S301), G283 (= G302), R285 (= R304), G304 (= G323), R305 (= R324)
- binding (2s)-2-hydroxyoctanoic acid: Y128 (= Y132), N159 (≠ V164), G160 (= G165), R162 (= R167), H252 (= H269), R255 (= R272)
2a7pA Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 3-indolelactate (see paper)
38% identity, 97% coverage: 6:357/363 of query aligns to 2:338/353 of 2a7pA
- active site: S105 (= S109), Y128 (= Y132), T153 (= T158), D155 (= D160), K228 (= K245), H252 (= H269)
- binding 3-(indol-3-yl) lactate: Y128 (= Y132), R162 (= R167), H252 (= H269)
- binding flavin mononucleotide: Y23 (= Y27), P76 (= P80), T77 (≠ M81), A78 (≠ G82), S105 (= S109), Q126 (= Q130), Y128 (= Y132), T153 (= T158), K228 (= K245), H252 (= H269), G253 (= G270), R255 (= R272), D281 (= D300), S282 (= S301), G283 (= G302), R285 (= R304), G304 (= G323), R305 (= R324)
1huvA Crystal structure of a soluble mutant of the membrane-associated (s)- mandelate dehydrogenase from pseudomonas putida at 2.15a resolution (see paper)
37% identity, 97% coverage: 6:357/363 of query aligns to 2:334/349 of 1huvA
- active site: S105 (= S109), Y128 (= Y132), T153 (= T158), D155 (= D160), K224 (= K245), H248 (= H269)
- binding flavin mononucleotide: Y23 (= Y27), P76 (= P80), T77 (≠ M81), G78 (= G82), S105 (= S109), Q126 (= Q130), Y128 (= Y132), T153 (= T158), K224 (= K245), H248 (= H269), G249 (= G270), R251 (= R272), D277 (= D300), S278 (= S301), G279 (= G302), R281 (= R304), G300 (= G323), R301 (= R324)
6a24A The crystal structure of mandelate oxidase with 3-fluoropyruvate (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 3:342/354 of 6a24A
- active site: Y126 (= Y132), D154 (= D160), H250 (= H269)
- binding flavin mononucleotide: P75 (= P80), V76 (≠ M81), A77 (≠ G82), Q124 (= Q130), Y126 (= Y132), T152 (= T158), K226 (= K245), H250 (= H269), G251 (= G270), R253 (= R272), D281 (= D300), G282 (≠ S301), G283 (= G302), R285 (= R304), G304 (= G323), R305 (= R324)
- binding pyruvic acid: R161 (= R167), H250 (= H269), R253 (= R272)
5zzqA The crystal structure of mandelate oxidase with (s)-4-hydroxymandelic acid (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 3:342/355 of 5zzqA
- active site: Y126 (= Y132), D154 (= D160), H250 (= H269)
- binding flavin mononucleotide: P75 (= P80), V76 (≠ M81), A77 (≠ G82), Q124 (= Q130), Y126 (= Y132), T152 (= T158), K226 (= K245), H250 (= H269), R253 (= R272), D281 (= D300), G283 (= G302), R285 (= R304), G304 (= G323), R305 (= R324)
- binding (2S)-hydroxy(4-hydroxyphenyl)ethanoic acid: L106 (≠ V111), Y126 (= Y132), M158 (≠ V164), R161 (= R167), T200 (≠ E211), F204 (≠ Y215), H250 (= H269), R253 (= R272)
6a1wA Mandelate oxidase with the enoyl fmn epoxide adduct (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 4:321/334 of 6a1wA
- active site: Y127 (= Y132), D155 (= D160), H229 (= H269)
- binding 1-[(1aR,11R)-11-acetyl-8,9-dimethyl-2,4-dioxo-3,4-dihydrobenzo[g]oxazireno[3,2-e]pteridin-11-ium-6(2H)-yl]-1-deoxy-5-O-phosphono-D-ribitol: L24 (≠ I28), A75 (= A79), P76 (= P80), V77 (≠ M81), Q125 (= Q130), Y127 (= Y132), T153 (= T158), R162 (= R167), K205 (= K245), H229 (= H269), R232 (= R272), D260 (= D300), G262 (= G302), R264 (= R304), G283 (= G323), R284 (= R324)
- binding magnesium ion: D260 (= D300), G261 (≠ S301), I263 (= I303), L281 (≠ F321)
6a00A The crystal structure of mandelate oxidase with (s)-2-phenylpropionate (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 4:321/334 of 6a00A
- active site: Y127 (= Y132), D155 (= D160), H229 (= H269)
- binding (2~{S})-2-phenylpropanoic acid: L107 (≠ V111), Y127 (= Y132), M159 (≠ V164), H229 (= H269), R232 (= R272)
- binding flavin mononucleotide: P76 (= P80), V77 (≠ M81), A78 (≠ G82), Q125 (= Q130), Y127 (= Y132), T153 (= T158), K205 (= K245), H229 (= H269), R232 (= R272), D260 (= D300), G262 (= G302), R264 (= R304), G283 (= G323), R284 (= R324)
- binding magnesium ion: D260 (= D300), G261 (≠ S301), I263 (= I303), L281 (≠ F321)
5zzrA The crystal structure of mandelate oxidase with (s)-mandelic acid (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 4:321/334 of 5zzrA
- active site: Y127 (= Y132), D155 (= D160), H229 (= H269)
- binding flavin mononucleotide: P76 (= P80), V77 (≠ M81), A78 (≠ G82), Q125 (= Q130), Y127 (= Y132), T153 (= T158), K205 (= K245), H229 (= H269), R232 (= R272), D260 (= D300), G262 (= G302), R264 (= R304), G283 (= G323), R284 (= R324)
- binding (s)-mandelic acid: V44 (≠ I48), L107 (≠ V111), Y127 (= Y132), M159 (≠ V164), R162 (= R167), H229 (= H269), R232 (= R272), E242 (= E282)
Sites not aligning to the query:
5zzxA The crystal structure of mandelate oxidase mutant y128f with (r)- mandelic acid (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 4:321/333 of 5zzxA
- active site: F127 (≠ Y132), D155 (= D160), H229 (= H269)
- binding flavin mononucleotide: P76 (= P80), V77 (≠ M81), A78 (≠ G82), F127 (≠ Y132), T153 (= T158), K205 (= K245), H229 (= H269), R232 (= R272), D260 (= D300), G262 (= G302), R264 (= R304), G283 (= G323), R284 (= R324)
- binding (r)-mandelic acid: L107 (≠ V111), M159 (≠ V164), R162 (= R167), H229 (= H269), R232 (= R272)
6a1bA Mandelate oxidase mutant-y128f with 3,3,3-trifluoro-2,2- dihydroxypropanoic acid (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 4:321/334 of 6a1bA
- active site: F127 (≠ Y132), D155 (= D160), H229 (= H269)
- binding 3,3,3-trifluoro-2,2-dihydroxypropanoic acid: F127 (≠ Y132), M159 (≠ V164), R162 (= R167), H229 (= H269), R232 (= R272)
- binding flavin mononucleotide: P76 (= P80), V77 (≠ M81), A78 (≠ G82), Q125 (= Q130), F127 (≠ Y132), T153 (= T158), K205 (= K245), H229 (= H269), R232 (= R272), D260 (= D300), G261 (≠ S301), G262 (= G302), R264 (= R304), G283 (= G323), R284 (= R324)
6a11A Mandelate oxidase mutant-y128f with phenylpyruvic acid (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 4:321/334 of 6a11A
- active site: F127 (≠ Y132), D155 (= D160), H229 (= H269)
- binding flavin mononucleotide: P76 (= P80), V77 (≠ M81), A78 (≠ G82), Q125 (= Q130), F127 (≠ Y132), T153 (= T158), K205 (= K245), H229 (= H269), R232 (= R272), D260 (= D300), G262 (= G302), R264 (= R304), G283 (= G323), R284 (= R324)
- binding 3-phenylpyruvic acid: Y79 (≠ M83), M159 (≠ V164), R162 (= R167), H229 (= H269), R232 (= R272)
6a21A Mandelate oxidase mutant-y128f with the n5-malonyl-fmn adduct (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 3:320/333 of 6a21A
- active site: F126 (≠ Y132), D154 (= D160), H228 (= H269)
- binding 3-[7,8-dimethyl-2,4-bis(oxidanylidene)-10-[(2S,3S,4R)-2,3,4-tris(oxidanyl)-5-phosphonooxy-pentyl]-1H-benzo[g]pteridin-5-yl]-3-oxidanylidene-propanoic acid: P75 (= P80), V76 (≠ M81), A77 (≠ G82), Q124 (= Q130), F126 (≠ Y132), T152 (= T158), M158 (≠ V164), K204 (= K245), H228 (= H269), R231 (= R272), D259 (= D300), G261 (= G302), R263 (= R304), G282 (= G323), R283 (= R324)
6a08A The crystal structure of mandelate oxidase with benzoyl-formic acid (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 4:322/335 of 6a08A
- active site: Y127 (= Y132), D155 (= D160), H230 (= H269)
- binding benzoyl-formic acid: A78 (≠ G82), Y127 (= Y132), V156 (= V161), W158 (≠ E163), M159 (≠ V164), M159 (≠ V164), F184 (= F217), H230 (= H269), R233 (= R272)
- binding flavin mononucleotide: P76 (= P80), V77 (≠ M81), A78 (≠ G82), Q125 (= Q130), Y127 (= Y132), T153 (= T158), K206 (= K245), H230 (= H269), G231 (= G270), R233 (= R272), D261 (= D300), G263 (= G302), R265 (= R304), G284 (= G323), R285 (= R324)
- binding magnesium ion: D261 (= D300), G262 (≠ S301), I264 (= I303), L282 (≠ F321)
6a36A Mandelate oxidase mutant-y128f with the 3-fluoropyruvic acid fmn adduct (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 3:320/331 of 6a36A
- active site: F126 (≠ Y132), D154 (= D160), H228 (= H269)
- binding 1-{5-[(3S)-3-carboxy-4-fluoro-3-hydroxybutanoyl]-7,8-dimethyl-2,4-dioxo-1,3,4,5-tetrahydrobenzo[g]pteridin-10(2H)-yl}-1-deoxy-5-O-phosphono-D-ribitol: L23 (≠ I28), P75 (= P80), V76 (≠ M81), A77 (≠ G82), Q124 (= Q130), F126 (≠ Y132), T152 (= T158), M158 (≠ V164), R161 (= R167), K204 (= K245), H228 (= H269), R231 (= R272), D259 (= D300), G260 (≠ S301), G261 (= G302), R263 (= R304), G282 (= G323), R283 (= R324)
- binding 1-deoxy-1-{5-[(1S)-2-fluoro-1-hydroxyethyl]-7,8-dimethyl-2,4-dioxo-1,3,4,5-tetrahydrobenzo[g]pteridin-10(2H)-yl}-5-O-phosphono-D-ribitol: P75 (= P80), V76 (≠ M81), Q124 (= Q130), F126 (≠ Y132), T152 (= T158), K204 (= K245), H228 (= H269), R231 (= R272), D259 (= D300), G260 (≠ S301), G261 (= G302), R263 (= R304), G282 (= G323), R283 (= R324)
6a0bA The crystal structure of mandelate oxidase mutant y128f with (r)-3,3, 3-trifluoro-2-hydroxy-propionic acid (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 3:320/332 of 6a0bA
- active site: F126 (≠ Y132), D154 (= D160), H228 (= H269)
- binding (2R)-3,3,3-trifluoro-2-hydroxypropanoic acid: F126 (≠ Y132), R161 (= R167), H228 (= H269), R231 (= R272)
- binding flavin mononucleotide: P75 (= P80), V76 (≠ M81), A77 (≠ G82), C104 (≠ S109), Q124 (= Q130), F126 (≠ Y132), T152 (= T158), K204 (= K245), H228 (= H269), R231 (= R272), D259 (= D300), G261 (= G302), R263 (= R304), G282 (= G323), R283 (= R324)
6a23A Mandelate oxidase mutant-y128f with the n5-benzyl-fmn adduct (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 3:320/333 of 6a23A
- active site: F126 (≠ Y132), D154 (= D160), H228 (= H269)
- binding benzoyl-formic acid: F126 (≠ Y132), V155 (= V161), W157 (≠ E163), M158 (≠ V164), F182 (= F217)
- binding 1-[5-(benzenecarbonyl)-7,8-dimethyl-2,4-dioxo-1,3,4,5-tetrahydrobenzo[g]pteridin-10(2H)-yl]-1-deoxy-5-O-phosphono-D-ribitol: L23 (≠ I28), P75 (= P80), V76 (≠ M81), A77 (≠ G82), L106 (≠ V111), Q124 (= Q130), F126 (≠ Y132), T152 (= T158), M158 (≠ V164), K204 (= K245), H228 (= H269), R231 (= R272), D259 (= D300), G261 (= G302), R263 (= R304), G282 (= G323), R283 (= R324)
- binding magnesium ion: D259 (= D300), G260 (≠ S301), I262 (= I303)
6a0gA The crystal structure of mandelate oxidase mutant y128f with b- phenyllactate (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 3:320/331 of 6a0gA
- active site: F126 (≠ Y132), D154 (= D160), H228 (= H269)
- binding flavin mononucleotide: P75 (= P80), V76 (≠ M81), A77 (≠ G82), Q124 (= Q130), F126 (≠ Y132), T152 (= T158), K204 (= K245), H228 (= H269), R231 (= R272), D259 (= D300), R263 (= R304), G282 (= G323), R283 (= R324)
- binding alpha-hydroxy-beta-phenyl-propionic acid: F22 (≠ Y27), V43 (≠ I48), L106 (≠ V111), M158 (≠ V164), H228 (= H269), R231 (= R272), E241 (= E282)
Sites not aligning to the query:
6a1nA Mandelate oxidase mutant-y128f with (2r,3s)-3-fluoro-2-hydroxy-3- phenylpropanoic acid (see paper)
38% identity, 98% coverage: 8:361/363 of query aligns to 3:320/332 of 6a1nA
- active site: F126 (≠ Y132), D154 (= D160), H228 (= H269)
- binding (2R,3S)-3-fluoro-2-hydroxy-3-phenylpropanoic acid: R42 (≠ A47), V43 (≠ I48), A77 (≠ G82), Y78 (≠ M83), L106 (≠ V111), M158 (≠ V164), R161 (= R167), H228 (= H269), R231 (= R272), E241 (= E282)
- binding flavin mononucleotide: P75 (= P80), V76 (≠ M81), A77 (≠ G82), Q124 (= Q130), F126 (≠ Y132), T152 (= T158), K204 (= K245), H228 (= H269), G229 (= G270), R231 (= R272), D259 (= D300), G260 (≠ S301), G261 (= G302), R263 (= R304), G282 (= G323), R283 (= R324)
Sites not aligning to the query:
Query Sequence
>GFF755 FitnessBrowser__Phaeo:GFF755
MGAGAIHSAEDARRLARRRLPWMVFDYIDGAAGQETGAARNRAALDAITLRPRILRDVSQ
RSLATSIFGAETDRPFGIAPMGMCNLAAPGADLMLARLAAHHRVPHGVSTVASTPLEILL
EAAEGYAWFQLYFSGDGTGTFKLAERARAAGYQTLVLTVDVPEVGRRPRELRHGFKMPFR
IGPRQFIDFALHPRWSLATLLKGKPVMANFEMEGYDFDRTESRARATWDTLARLRDLWPG
KLVVKGVLDVEDARALVSAGADAIQISSHGARQLEAAPAPIEMLAKIRADFGPTFPVFYD
SGIRSGEDVLKAITTGADFVFLGRILQYAIAARGEAGLEQLWDALSEELSIAMAQTGRVS
LAT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory