Comparing GFF769 FitnessBrowser__Phaeo:GFF769 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
36% identity, 93% coverage: 8:363/384 of query aligns to 8:358/380 of 7rsfA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
28% identity, 100% coverage: 1:384/384 of query aligns to 1:376/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
28% identity, 100% coverage: 1:384/384 of query aligns to 5:380/380 of 5vo3A
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
31% identity, 90% coverage: 33:378/384 of query aligns to 38:361/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
31% identity, 90% coverage: 33:378/384 of query aligns to 39:356/360 of 2f7vA
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 95% coverage: 3:367/384 of query aligns to 8:366/383 of 7uoiA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
28% identity, 88% coverage: 30:368/384 of query aligns to 29:360/377 of 7t1qA
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
27% identity, 99% coverage: 4:382/384 of query aligns to 4:374/375 of 4pqaA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
27% identity, 99% coverage: 4:382/384 of query aligns to 4:374/376 of 4o23A
7lgpB Dape enzyme from shigella flexneri
28% identity, 98% coverage: 8:382/384 of query aligns to 10:375/377 of 7lgpB
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
36% identity, 44% coverage: 1:168/384 of query aligns to 3:170/258 of 4h2kA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 66% coverage: 27:278/384 of query aligns to 35:294/407 of P37111
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
28% identity, 60% coverage: 62:293/384 of query aligns to 71:315/408 of Q03154
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
27% identity, 81% coverage: 68:379/384 of query aligns to 74:371/373 of 3rzaA
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
33% identity, 34% coverage: 24:152/384 of query aligns to 46:185/471 of 3dljA
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
33% identity, 34% coverage: 24:152/384 of query aligns to 75:216/507 of Q96KN2
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
25% identity, 88% coverage: 29:366/384 of query aligns to 44:363/426 of 3pfoA
Sites not aligning to the query:
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
33% identity, 32% coverage: 8:131/384 of query aligns to 26:152/458 of 2pokA
Sites not aligning to the query:
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
36% identity, 27% coverage: 66:170/384 of query aligns to 62:170/265 of 4op4B
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
28% identity, 40% coverage: 3:155/384 of query aligns to 16:186/475 of Q9D1A2
Sites not aligning to the query:
>GFF769 FitnessBrowser__Phaeo:GFF769
MMEQTTRILSDLIAYPTVSADSNLEMIAYLANRLEDCGARVDVMFDAGGQKANLFATLGP
DTDGGIVLSGHSDVVPVTDQDWTSDPFTMEEWDGRLYGRGTCDMKGFIAATLAMAPKFAE
QISRRPIHFAFTYDEEVGCIGAGHLVQALRERGLKPRLALIGEPTSMRVVEGHKGCHEYS
TRFQGLEGHGSNPGRGVNAVEYAARYVSRLLDLRGDLQQRTPPDSRFDPPWTTLNIGALN
GGSAHNVIASKAQVDWEMRPVQPSDADHVKDTMARYCRDTLLPAMQAIYPEASIETEVVG
EVAGLTPTTQNEARELMADLLGSNAAELVPFGTEAGLFQELGMDVVVCGPGSIAQAHKAD
EYLSLDQLSQCLTVLNRLAGRLAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory