Comparing GFF773 FitnessBrowser__Phaeo:GFF773 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
27% identity, 80% coverage: 43:310/335 of query aligns to 22:286/313 of P94529
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
30% identity, 78% coverage: 59:319/335 of query aligns to 16:268/285 of 7cagA
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
24% identity, 75% coverage: 82:333/335 of query aligns to 249:512/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
24% identity, 73% coverage: 82:326/335 of query aligns to 234:490/490 of 4ki0F
>GFF773 FitnessBrowser__Phaeo:GFF773
MHPAIQGLFTIAFGVGGCVGYFYFSNLVLDRVIFPARGAHIARNIRRANMIRPWLFLFPA
LLALGLYLAYPVVETLRLSVTERVPGGGSEFVGLANYQQMLAEAKFWEALQNNFLWLLVV
PAASTAFGLLAAQLTDRLAWGNIAKSLIFMPMAISFVGAAVIWKLVYDARPEGTDQIGVL
NALYIYFGGDGPMQWLTIPFWNSFFLMMVLIWIQTGFAMVILSAALRGIPEETVEAAIVD
GAGPFQIFFKIKVPQIMDTIVVVWTTITIVVLKVFDIVFAMTNGQWETQVLANYMYDKLF
RANDWGVGSASAMVIMLLVLPILVWNVYNARREMR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory