Comparing GFF773 FitnessBrowser__psRCH2:GFF773 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
50% identity, 98% coverage: 4:329/332 of query aligns to 17:335/336 of A3QCW5
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
26% identity, 93% coverage: 24:331/332 of query aligns to 1:308/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
26% identity, 93% coverage: 24:331/332 of query aligns to 1:308/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
26% identity, 93% coverage: 24:331/332 of query aligns to 1:308/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
26% identity, 93% coverage: 24:331/332 of query aligns to 1:308/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
26% identity, 93% coverage: 24:331/332 of query aligns to 2:309/310 of 7bbrA
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
27% identity, 89% coverage: 31:325/332 of query aligns to 6:307/314 of 4p8bA
4n8gA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0660), target efi-501075, with bound d-alanine-d-alanine (see paper)
30% identity, 84% coverage: 49:326/332 of query aligns to 26:307/325 of 4n8gA
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
24% identity, 94% coverage: 3:314/332 of query aligns to 7:312/328 of Q0B2F6
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
23% identity, 86% coverage: 29:314/332 of query aligns to 2:286/301 of 4n17A
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
23% identity, 86% coverage: 29:314/332 of query aligns to 2:286/301 of 4n15A
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
24% identity, 90% coverage: 29:328/332 of query aligns to 3:300/303 of 4pddA
7t3eA Structure of the sialic acid bound tripartite atp-independent periplasmic (trap) periplasmic component siap from photobacterium profundum (see paper)
25% identity, 83% coverage: 46:322/332 of query aligns to 21:294/300 of 7t3eA
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
22% identity, 86% coverage: 28:313/332 of query aligns to 4:287/304 of 4x8rA
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
26% identity, 77% coverage: 23:278/332 of query aligns to 3:250/312 of 4oanA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
27% identity, 61% coverage: 29:232/332 of query aligns to 3:207/301 of 4nq8B
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
23% identity, 91% coverage: 17:318/332 of query aligns to 18:314/329 of P44542
4ovrA Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d- galacturonate (see paper)
28% identity, 57% coverage: 33:221/332 of query aligns to 6:192/298 of 4ovrA
Sites not aligning to the query:
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
24% identity, 83% coverage: 37:313/332 of query aligns to 11:283/301 of 4mhfA
Sites not aligning to the query:
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
24% identity, 83% coverage: 37:313/332 of query aligns to 11:283/302 of 4mijA
Sites not aligning to the query:
>GFF773 FitnessBrowser__psRCH2:GFF773
MYKSCVAALVAALYWFSAPAMAAEAEPIVIKFAHVVADDTPKGKGALLLKQLVEQRMAGK
VKVEVYPNSTLVGDAEEMQALFDNKVQLLAPSMSKFAPYTKKLQVFDLPFLFDDAEALQR
FQKREAARQLLRSMADHGVYGLAYWNNGLKQLSATTPLRKPSDANGLAFRIQPSPVLEAQ
FAAVGAKSVVLPFAKVYESLKGGVVQGAENPWSNILSQNMHSVQPYITESNHGVLDYMLI
TNNDFWLSMPFAVRSELEGIILEVTQAVNREAAAVNRRDRERILASGSSQLITLTPEERQ
AWREQMLPVWKTYEADIGADLIRAAMTVNRRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory