SitesBLAST
Comparing GFF781 FitnessBrowser__WCS417:GFF781 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
32% identity, 89% coverage: 4:276/306 of query aligns to 10:291/318 of 2jg1A
- active site: G259 (= G244), S260 (≠ A245), G261 (= G246), D262 (= D247)
- binding phosphoaminophosphonic acid-adenylate ester: K46 (= K40), N193 (= N186), S230 (= S215), G232 (= G217), G235 (= G220), I252 (≠ V237), V254 (= V239), G259 (= G244), S260 (≠ A245), G261 (= G246), D262 (= D247), T264 (≠ L249), N286 (≠ T271), G289 (≠ A274), M290 (≠ A275)
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
32% identity, 89% coverage: 4:276/306 of query aligns to 7:288/315 of 2jg1C
- active site: G256 (= G244), S257 (≠ A245), G258 (= G246), D259 (= D247)
- binding phosphoaminophosphonic acid-adenylate ester: S227 (= S215), G229 (= G217), A230 (= A218), G232 (= G220), I246 (≠ P234), I249 (≠ V237), V251 (= V239), V255 (= V243), G256 (= G244), S257 (≠ A245), G258 (= G246), D259 (= D247), T261 (≠ L249), N283 (≠ T271), G286 (≠ A274), M287 (≠ A275)
- binding 6-O-phosphono-beta-D-tagatofuranose: D17 (= D14), G42 (= G39), K43 (= K40), R93 (= R90), C95 (≠ N92), L108 (≠ N106), G140 (= G138), S141 (= S139), D259 (= D247)
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
32% identity, 89% coverage: 4:276/306 of query aligns to 6:287/314 of 2jgvB
- active site: G255 (= G244), S256 (≠ A245), G257 (= G246), D258 (= D247)
- binding adenosine-5'-diphosphate: S226 (= S215), A229 (= A218), I248 (≠ V237), P253 (≠ T242), S256 (≠ A245), G257 (= G246), N282 (≠ T271), G285 (≠ A274), M286 (≠ A275)
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
30% identity, 91% coverage: 4:280/306 of query aligns to 3:288/319 of 2f02A
- binding adenosine-5'-triphosphate: N186 (= N186), S224 (= S215), G226 (= G217), I243 (≠ P234), I246 (≠ V237), G253 (= G244), S254 (≠ A245), G255 (= G246), T258 (≠ L249), M280 (≠ A272), G283 (≠ A275), M284 (= M276)
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
31% identity, 91% coverage: 4:280/306 of query aligns to 3:285/309 of 3ie7A
- binding adenosine-5'-triphosphate: N188 (= N186), S220 (= S215), G222 (= G217), A223 (= A218), G225 (= G220), V242 (= V237), G249 (= G244), A250 (= A245), G251 (= G246), D252 (= D247), S279 (≠ A274), V283 (= V278)
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
30% identity, 94% coverage: 1:288/306 of query aligns to 1:297/309 of 3uqdB
- active site: G253 (= G244), A254 (= A245), G255 (= G246), D256 (= D247)
- binding adenosine-5'-diphosphate: K185 (= K184), N187 (= N186), S224 (= S215), G226 (= G217), P227 (≠ A218), G229 (= G220), S248 (≠ V239), M258 (≠ L249), V280 (≠ T271), G283 (≠ A274), S284 (≠ A275)
- binding adenosine-5'-triphosphate: Y23 (≠ E23), K27 (≠ V27)
- binding 6-O-phosphono-beta-D-fructofuranose: K27 (≠ V27), R29 (= R29)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: D14 (= D14), G39 (= G39), N43 (= N43), R90 (= R90), R105 (≠ D104), S139 (= S139), G253 (= G244)
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
30% identity, 94% coverage: 1:288/306 of query aligns to 1:297/309 of 3uqdA
- active site: G253 (= G244), A254 (= A245), G255 (= G246), D256 (= D247)
- binding adenosine-5'-triphosphate: K185 (= K184), S224 (= S215), G226 (= G217), P227 (≠ A218), G229 (= G220), T251 (= T242), G255 (= G246), M258 (≠ L249), V280 (≠ T271), G283 (≠ A274), S284 (≠ A275), T287 (≠ V278)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D14), G38 (≠ A38), G39 (= G39), N43 (= N43), R90 (= R90), S139 (= S139), D256 (= D247)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: K27 (≠ V27), R29 (= R29)
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
30% identity, 94% coverage: 1:288/306 of query aligns to 1:297/309 of 3n1cA
- active site: G253 (= G244), A254 (= A245), G255 (= G246), D256 (= D247)
- binding 6-O-phosphono-beta-D-fructofuranose: D14 (= D14), K27 (≠ V27), R29 (= R29), G39 (= G39), N43 (= N43), R90 (= R90), G138 (= G138), S139 (= S139), D256 (= D247)
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 94% coverage: 1:288/306 of query aligns to 1:297/309 of P06999
- K27 (≠ V27) binding ; binding
- KPN 185:187 (= KPN 184:186) binding in other chain
- NQK 187:189 (≠ NTE 186:188) binding in other chain
- E190 (= E189) mutation to Q: Causes a 50-fold decrease in the kcat value and a 15-fold increment in the apparent KM for ATP.
- SLGPQG 224:229 (≠ SDGAAG 215:220) binding in other chain
- S248 (≠ V239) binding in other chain
- S250 (= S241) binding
- V252 (= V243) binding
- V280 (≠ T271) binding in other chain
- S284 (≠ A275) binding in other chain
- A286 (= A277) binding
- N289 (≠ Q280) binding
- G291 (= G282) binding
- R293 (≠ G284) binding
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
31% identity, 91% coverage: 1:277/306 of query aligns to 1:286/307 of 3uqeA
- active site: G253 (= G244), A254 (= A245), G255 (= G246), D256 (= D247)
- binding adenosine-5'-triphosphate: K185 (= K184), N187 (= N186), S224 (= S215), G226 (= G217), P227 (≠ A218), G229 (= G220), S248 (≠ V239), A254 (= A245), G255 (= G246), M258 (≠ L249), V280 (≠ T271), G283 (≠ A274), S284 (≠ A275)
- binding pyrophosphate 2-: N187 (= N186), K189 (≠ E188)
Sites not aligning to the query:
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
31% identity, 91% coverage: 1:277/306 of query aligns to 1:286/304 of 3cqdA
- active site: G253 (= G244), A254 (= A245), G255 (= G246), D256 (= D247)
- binding adenosine-5'-triphosphate: Y23 (≠ E23), G26 (≠ E26), K27 (≠ V27), K185 (= K184), N187 (= N186), N187 (= N186), K189 (≠ E188), S224 (= S215), G226 (= G217), P227 (≠ A218), G229 (= G220), S248 (≠ V239), T251 (= T242), A254 (= A245), G255 (= G246), M258 (≠ L249), V280 (≠ T271), G283 (≠ A274), S284 (≠ A275)
Sites not aligning to the query:
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
30% identity, 91% coverage: 4:280/306 of query aligns to 3:278/298 of 3julA
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 91% coverage: 3:279/306 of query aligns to 13:298/339 of P9WID3
- K283 (≠ Q265) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
29% identity, 83% coverage: 4:258/306 of query aligns to 3:273/320 of 2ajrA
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
28% identity, 91% coverage: 1:278/306 of query aligns to 1:290/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N186), K225 (≠ S215), G227 (= G217), I246 (≠ P234), A248 (≠ K236), A257 (= A245), G258 (= G246), F261 (≠ L249), A286 (= A274), S287 (≠ A275)
- binding alpha-D-ribofuranose: N12 (≠ A12), D14 (= D14), G40 (= G39), K41 (= K40), N44 (= N43), E144 (≠ S139), D259 (= D247)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 87% coverage: 14:278/306 of query aligns to 80:356/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
8cqxA Ribokinase from t.Sp mutant a92g
29% identity, 88% coverage: 13:282/306 of query aligns to 10:283/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (≠ G175), T217 (≠ S215), G219 (= G217), A220 (= A218), G222 (= G220), F250 (≠ L249), N272 (≠ T271), G275 (≠ A274), A276 (= A275), T279 (≠ V278)
- binding magnesium ion: D242 (≠ S241), T244 (≠ V243), A278 (= A277)
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
27% identity, 87% coverage: 23:288/306 of query aligns to 18:288/309 of Q53W83
- GAEVN 34:38 (≠ GKGVN 39:43) binding
- YYR 103:105 (≠ --Q 98) binding
- R167 (vs. gap) binding
- S193 (≠ N186) binding
- 219:225 (vs. 215:221, 43% identical) binding
- GAGD 248:251 (= GAGD 244:247) binding
- D251 (= D247) binding
- N275 (≠ T271) binding
- D287 (= D287) binding
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
27% identity, 87% coverage: 23:288/306 of query aligns to 18:288/300 of 1v1bA
- active site: G248 (= G244), A249 (= A245), G250 (= G246), D251 (= D247)
- binding adenosine-5'-triphosphate: K219 (≠ S215), G221 (= G217), A238 (≠ P234), F239 (≠ P235), V241 (= V237), G248 (= G244), A249 (= A245), G250 (= G246), N275 (≠ T271), A279 (= A275)
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
27% identity, 87% coverage: 23:288/306 of query aligns to 18:288/301 of 1v1aA
- active site: G248 (= G244), A249 (= A245), G250 (= G246), D251 (= D247)
- binding adenosine-5'-diphosphate: K219 (≠ S215), G221 (= G217), A222 (= A218), A249 (= A245), G250 (= G246), N275 (≠ T271), A279 (= A275)
- binding 2-keto-3-deoxygluconate: G34 (= G39), A35 (≠ K40), N38 (= N43), Y89 (vs. gap), R105 (≠ Q98), R167 (vs. gap), G248 (= G244), D251 (= D247), D287 (= D287)
Sites not aligning to the query:
Query Sequence
>GFF781 FitnessBrowser__WCS417:GFF781
MARILTLTLNPALDLTVRLARLEPGEVNRSETLLTHAAGKGVNVAQVLADLGHELTVSGF
LGEGNPQAFEALIAQRGFTDAFIRVPGETRSNIKIAEQDGRVTDINAPGPQVTEQAQNAL
LDKLAQIAPGFDAVVVAGSLPRGVSPQWFKGLLEQLKRYGLKVALDTSGEALRAGLLAGP
WLVKPNTEELAEALDNATDAVSQLHRQGVEHVVVSDGAAGVSWYSPNAALQATPPKVTVA
STVGAGDSLLAGMLHGLLTGDTPEQTLRRATAIAAMAVTQIGFGISDHAQLARLESGVQV
RSLTEQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory